DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rictor and Rictor

Sequence 1:NP_573371.1 Gene:rictor FlyBaseID:FBgn0031006 Length:1936 Species:Drosophila melanogaster
Sequence 2:XP_008759028.1 Gene:Rictor RGDID:1307224 Length:1697 Species:Rattus norvegicus

Alignment Length:1754 Identity:498/1755 (28%)
Similarity:806/1755 (46%) Gaps:290/1755 (17%)


  Fly    76 GSHHSNIRFTTEELLYCLSASLVHTFTQVRAAALRTIRYAISTPNDIKTFNALQLQHLLCRSIDL 140
            |.....:.|..|:::.||..:|::...:||||.||.:||.|...:.::....|::.:|:.|.||:
  Rat    59 GHSEEKLGFNYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI 123

  Fly   141 MLKNDDERVQALKLVRKMLAIAPEDISPAVVRCLVSLADSGIEENDNLLRACLATLAEFAVLNPA 205
            ...|:.||.|||:|||||:.:.......:|...|:::.:.|::|.|.::|||:|.:.|.|:.||.
  Rat   124 QQSNEVERTQALRLVRKMITVNASLFPSSVANSLIAVGNDGLQERDRMVRACIAIICELALQNPE 188

  Fly   206 LLIVCGGVTSITRNVLECHNPRIAESLCGVLLYLLEWPQTRNI--CGVRLDCLAAPYCDFTYRQS 268
            ::.:.||:.:|.:||::|...||.|:|...:|:||..|:||..  ..|.|:.:.|||.||.||.|
  Rat   189 VVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS 253

  Fly   269 ---IVDKNKDARELRYTSCRLALLSVLRSWTGTLEFCDPSKPSGLKAIVDALYLNQIEVRKAILD 330
               ...:.|:.||.|:.:.::.:::..|||.|.:..|.|.. ||:::::..|.:..:|:|:.:|:
  Rat   254 PDTAEGQLKEDREARFLASKMGIIATFRSWAGIINLCKPGN-SGIQSLIGVLCIPNMEIRRGLLE 317

  Fly   331 LLYELLTLPQPTWTDDYAVALQAVDPSDFQDTWLLSNGFVSAEGRSILPTLAARAPSVVEQHLAL 395
            :||::..||.|..||::..||.:|||..|||:|.||:|||:||.::|||..|...|.:::.:|||
  Rat   318 VLYDIFRLPLPVVTDEFIEALLSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLAL 382

  Fly   396 MLYCFLETGLLNALVEVVVSSDQFVSVQATVLIGKILQLMHTHLPPDICCTSPALPTLVSHATL- 459
            :|..|:..|||..||||:.:||..:||:||:|:|::|.:.:|.||.........||||::.|.. 
  Rat   383 ILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASF 447

  Fly   460 -----GNQQANAAVAALQNYQKLLRQRPASRSLFLDSIIQGGALIQTRLFR-RHLNVQEQAGPVL 518
                 ...:|:||:..|:.:.::.::.|...||.||.|||  ..|.|...| ::|.||:.   :.
  Rat   448 DIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQ--KAIATHQKRDQYLRVQKD---IF 507

  Fly   519 QLQETAEAAAFAVPPVTQFRGTLDRSRLDSVSSSDESNSQASTSSRSSFRLKRKFLPQALYDNFR 583
            .|::|.|                                                   ||..|.|
  Rat   508 VLKDTEE---------------------------------------------------ALLINLR 521

  Fly   584 AFNRLLTDSRVLSQADAHLWDWDVITTILK---SNLIRKLDYTQGKFLKRLVDFYKPRNNRFSHQ 645
                   ||:||...:...|:|::|.||||   .||....|....:|::||:.||||.:..::..
  Rat   522 -------DSQVLQHKENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYASL 579

  Fly   646 DL--VPGQRLPTYVSAGLDLIDVLLSSNELECMRFITDYFSDISQQLAAVTTSNRAHDCLFSPQH 708
            ||  ...::|..   .|....:.||.|.| :...::.|...||.|.|.|  :|....:.......
  Rat   580 DLDFAKSKQLTV---VGCQFTEFLLESEE-DGQGYLEDLVKDIVQWLNA--SSGMKPERSLQNNG 638

  Fly   709 MNNTMCQQYFLYIGRMCRTVKGIEVLKNTTVFEYLINL--VRVTDHVCYVKLIVSGLNYSYEKLP 771
            :..|:.|.|||:||.:.....|:::|:..:||:.|:||  ::..||:  :||.||.|:||.:.|.
  Rat   639 LLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHL--LKLTVSSLDYSRDGLA 701

  Fly   772 RQVLEKALTSAKTRGRLYSTQFMAVLLRARLPHFEVWGIPLIINQTRDSDRSVGLAAMDVLEEAC 836
            |.:|.|.||:|....|||:|:.:.|||||.:..|..|||.|::.|..|.::::...|:|:|:|||
  Rat   702 RVILSKVLTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEAC 766

  Fly   837 HDKYYLEEIVSRWPNLTHRGDAGRLLMARYYSLPRGLNSTMAR--IEDEIRYWRNGYNKRYVLLV 899
            .||..|..::...|.|:|.||.|.||:.|:.|:|:|.:....|  :..::..|...||.:||.|:
  Rat   767 EDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHKEYNSKYVDLI 831

  Fly   900 EADTHSSLTLHIRNEDGYYSRRNCNQRPQTVPPNVAPHLYGQMAQTGQGMTALRKHGDLPQLLEL 964
            |...:.:||.:.:..||....|..|||.|.....:..|||||:.....|...|.....:.:|.:.
  Rat   832 EEQLNEALTTYRKPIDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQSIITELCQN 896

  Fly   965 LRRAKCTDDAECLELKAAIWALAHASTHSNGIEYFVELNARLYEKLIVLVTKCEVYSVRATCFSA 1029
            :|........|..:|||::|||.:..:.:.|:....|.|  :...::.|..:|||.|:|.||...
  Rat   897 VRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEEN--VIPDILKLAKQCEVLSIRGTCVYV 959

  Fly  1030 LGLIAGTQAGANILFKLNWLSVRHDKNTMWPVHQPED---------------WMSSQYTPVRHYY 1079
            |||||.|:.|.:||...:|.||||.:..:||| .|:|               .::|:.|..||..
  Rat   960 LGLIAKTKQGCDILKCHSWDSVRHSRKHLWPV-VPDDVEQLCNELSSVPSTLSLNSESTSSRHNS 1023

  Fly  1080 EDVPA-DNMTMMDDYIERF--YETGSDFWHMLADQTDASGGGGG----------------VAGTV 1125
            |...| .:|.:::|  :||  ..|.:.|..:..|...|.....|                |...:
  Rat  1024 ESESAPSSMFILED--DRFGSSSTSTFFLDINEDAEPAFYDRPGPIKDKNSFPFFASSKLVKNRI 1086

  Fly  1126 VG-------MHPIVQDP------NATITTTDSVRTTT----DDVHPRMLVGVAAKSKTL------ 1167
            :.       .|....||      :...|:...:||.|    |..|......::...|||      
  Rat  1087 LNSLTLPTKKHRSSSDPKGGKLSSENKTSNRRIRTFTEPSVDFNHSDDFTNISPAQKTLQLETSF 1151

  Fly  1168 ---------------------------PEGSNLRQ-------------GKHQRSLSESKTTDVIS 1192
                                       ||  |.|:             |.|.:..|:|..||..:
  Rat  1152 VGNKHLEDTGSTPSIGDNDLKFPKSFGPE--NHRENTSRERLVVESSAGSHMKIRSQSFNTDTTT 1214

  Fly  1193 LLGSGVGTMSGAVLYPTPYQHRIRYNSCT-DSNTSGVSSCESV-TGRTAAAYAAAANEL-----Q 1250
               ||:.:||.     :|.:..:..:|.| |::...:|:..|. |.:|:......||.|     .
  Rat  1215 ---SGISSMSS-----SPSRETVAVDSTTMDTDCGSLSTVVSTKTVKTSHYLTPQANHLSLSKSN 1271

  Fly  1251 QFPLSP------IPSMSNLLESDELFRRNQLATSMLPSTLSPMAMKGYVQLRSL-RKHSRPVFSE 1308
            ...|.|      :|..:..|::..:.....||......|.|..|. ||..|:.| ::...|..|.
  Rat  1272 SVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAF-GYATLKRLQQQRMHPSLSH 1335

  Fly  1309 SSAEFYDFAEILDTPEVQMR------KLDWTHSHRRLKVRSLDRQLSDVYRRLSADELNVLLPTL 1367
            |.|......::|.|..:.|:      :|..:...:.|...|||::  |:   ||....|.|..:.
  Rat  1336 SEALASPAKDVLFTDTITMKANSFESRLTPSRFMKALSYASLDKE--DL---LSPINQNTLQRSS 1395

  Fly  1368 NAPKFLPPNDLKG-PCYAGICLPKNVLDLFPTRNLSRTYVSRDIQDQDIVGI------------- 1418
            :....:......| ..|.|:.||.::.|:|..:::. .:.|:.:...|..|.             
  Rat  1396 SVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIP-YFQSKHVPPPDDRGARTFSHDGGGLPSG 1459

  Fly  1419 ------NLLNTMLRPQCLNDSLTNEGGDESSVISSLSDVSSASRRQTRQLQQGAKHSRSLCLHC- 1476
                  |..:.:.:...|.:.:.:...|.|..:.|..|..         ||:   |:...||:| 
  Rat  1460 TGSLVKNSFHLLRQQMSLTEIMNSVHSDASLFLESTEDTG---------LQE---HTDDNCLYCV 1512

  Fly  1477 -----ARSPRQQRNDSGSHSNGGGGASLAPCELYSSAAAALVAAGIQAGPVLAKKSGSS--AQGA 1534
                 ...|..|.:...|||:    ....|   ||......:...::..|  :|.||.|  :.||
  Rat  1513 CIEILGFQPSNQLSSICSHSD----LQDIP---YSDWCEQPIHNPLEVVP--SKFSGISGCSDGA 1568

  Fly  1535 SAALGADISFHSPESMLSEDSLPD-------RLTASILYNVQRLANPVSAKQSKMALLELKQKHP 1592
            |...|:..|..|.|.:|...::||       .|...:|..|..|::.||.|..:..||.:|:|:|
  Rat  1569 SQEEGSASSTKSTELLLGVKTIPDDTPMCRILLRKEVLRLVVNLSSSVSTKCHETGLLTIKEKYP 1633

  Fly  1593 HAFQDICLYSEACKTIGRSSYRMIARRFLQELFLDLNFDSFYVEPQ--LIIGARKFSAEEKAEA 1654
            ..|.|||||||....:...::|:..|||:||||.|:.|...:.|.:  |.|...:...:|.||:
  Rat  1634 QTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDVQFLQMHEEAEAVLAIPPNQPIVDESAES 1697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rictorNP_573371.1 RICTOR_N 63..440 CDD:291336 137/369 (37%)
RICTOR_M 583..798 CDD:291338 73/222 (33%)
RasGEF_N_2 805..908 CDD:291335 37/105 (35%)
RICTOR_V 977..1047 CDD:291340 26/70 (37%)
RictorXP_008759028.1 RICTOR_N 60..425 CDD:291336 135/366 (37%)
RICTOR_M 513..728 CDD:291338 77/281 (27%)
RasGEF_N_2 735..841 CDD:291335 38/106 (36%)
RICTOR_V 910..976 CDD:291340 26/68 (38%)
RICTOR_phospho 1072..1176 CDD:291337 13/104 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343921789
eggNOG 1 0.900 E1_KOG3694
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 644 1.000 Inparanoid score I758
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D128601at2759
OrthoFinder 1 1.000 FOG0003100
OrthoInspector 1 1.000 T1088694
orthoMCL 1 0.900 OOG5_130440
Panther 1 1.100 LDO PTHR13298
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.