DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rictor and RICTOR

Sequence 1:NP_573371.1 Gene:rictor FlyBaseID:FBgn0031006 Length:1936 Species:Drosophila melanogaster
Sequence 2:NP_001272368.1 Gene:RICTOR HGNCID:28611 Length:1732 Species:Homo sapiens

Alignment Length:1859 Identity:514/1860 (28%)
Similarity:830/1860 (45%) Gaps:341/1860 (18%)


  Fly    13 RSKLQLRIKVSQDP-EDFYRLDPQRSAAENAFEIYSMLC-LEETRDTKRLFLLNALASLCLGARK 75
            ||...||::...|. |:...||..|..::|..||...:. |:...:.::|..||....|....  
Human     8 RSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDI-- 70

  Fly    76 GSHHSNIRFTTEELLYCLSASLVHTFTQVRAAALRTIRYAISTPNDIKTFNALQLQHLLCRSIDL 140
            |.....:.|..|:::.||..:|::...:||||.||.:||.|...:.::....|::.:|:.|.||:
Human    71 GHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDI 135

  Fly   141 MLKNDDERVQALKLVRKMLAIAPEDISPAVVRCLVSLADSGIEENDNLLRACLATLAEFAVLNPA 205
            ...|:.||.|||:|||||:.:.......:|...|:::.:.|::|.|.::|||:|.:.|.|:.||.
Human   136 QQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPE 200

  Fly   206 LLIVCGGVTSITRNVLECHNPRIAESLCGVLLYLLEWPQTRNI--CGVRLDCLAAPYCDFTYRQS 268
            ::.:.||:.:|.:||::|...||.|:|...:|:||..|:||..  ..|.|:.:.|||.||.||.|
Human   201 VVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHS 265

  Fly   269 ---IVDKNKDARELRYTSCRLALLSVLRSWTGTLEFCDPSKPSGLKAIVDALYLNQIEVRKAILD 330
               ...:.|:.||.|:.:.::.:::..|||.|.:..|.|.. ||:::::..|.:..:|:|:.:|:
Human   266 PDTAEGQLKEDREARFLASKMGIIATFRSWAGIINLCKPGN-SGIQSLIGVLCIPNMEIRRGLLE 329

  Fly   331 LLYELLTLPQPTWTDDYAVALQAVDPSDFQDTWLLSNGFVSAEGRSILPTLAARAPSVVEQHLAL 395
            :||::..||.|..|:::..||.:|||..|||:|.||:|||:||.::|||..|...|.:::.:|||
Human   330 VLYDIFRLPLPVVTEEFIEALLSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLAL 394

  Fly   396 MLYCFLETGLLNALVEVVVSSDQFVSVQATVLIGKILQLMHTHLPPDICCTSPALPTLVSHATL- 459
            :|..|:..|||..||||:.:||..:||:||:|:|::|.:.:|.||.........||||::.|.. 
Human   395 ILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASF 459

  Fly   460 -----GNQQANAAVAALQNYQKLLRQRPASRSLFLDSIIQGGALIQTRLFR-RHLNVQEQAGPVL 518
                 ...:|:||:..|:.:.::.::.|...||.||.|||  ..|.|...| ::|.||:.   :.
Human   460 DIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQ--KAIATHQKRDQYLRVQKD---IF 519

  Fly   519 QLQETAEAAAFAVPPVTQFRGTLDRSRLDSVSSSDESNSQASTSSRSSFRLKRKFLPQALYDNFR 583
            .|::|.|                                                   ||..|.|
Human   520 ILKDTEE---------------------------------------------------ALLINLR 533

  Fly   584 AFNRLLTDSRVLSQADAHLWDWDVITTILK---SNLIRKLDYTQGKFLKRLVDFYKPRNNRFSHQ 645
                   ||:||...:...|:|::|.||||   .||....|....:|::||:.||||.:..:::.
Human   534 -------DSQVLQHKENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANL 591

  Fly   646 DL--VPGQRLPTYVSAGLDLIDVLLSSNELECMRFITDYFSDISQQLAAVTTSNRAHDCLFSPQH 708
            ||  ...::|..   .|....:.||.|.| :...::.|...||.|.|.|  :|....:.......
Human   592 DLDFAKAKQLTV---VGCQFTEFLLESEE-DGQGYLEDLVKDIVQWLNA--SSGMKPERSLQNNG 650

  Fly   709 MNNTMCQQYFLYIGRMCRTVKGIEVLKNTTVFEYLINL--VRVTDHVCYVKLIVSGLNYSYEKLP 771
            :..|:.|.|||:||.:.....|:::|:..:||:.|:||  ::..||:  :||.||.|:||.:.|.
Human   651 LLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHL--LKLTVSSLDYSRDGLA 713

  Fly   772 RQVLEKALTSAKTRGRLYSTQFMAVLLRARLPHFEVWGIPLIINQTRDSDRSVGLAAMDVLEEAC 836
            |.:|.|.||:|....|||:|:.:.|||||.:..|..|||.|::.|..|.::::...|:|:|:|||
Human   714 RVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEAC 778

  Fly   837 HDKYYLEEIVSRWPNLTHRGDAGRLLMARYYSLPRGLNSTMAR--IEDEIRYWRNGYNKRYVLLV 899
            .||..|..::...|.|:|.||.|.||:.|:.|:|:|.:....|  :..::..|...||.:||.|:
Human   779 EDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYVDLI 843

  Fly   900 EADTHSSLTLHIRNEDGYYSRRNCNQRPQTVPPNVAPHLYGQMAQTGQGMTALRKHGDLPQLLEL 964
            |...:.:||.:.:..||....|..|||.|.....:..|||||:.....|...|.....:.:|...
Human   844 EEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRN 908

  Fly   965 LRRAKCTDDAECLELKAAIWALAHASTHSNGIEYFVELNARLYEKLIVLVTKCEVYSVRATCFSA 1029
            :|........|..:|||::|||.:..:.:.|:....|.|  :...::.|..:|||.|:|.||...
Human   909 VRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEEN--VIPDILKLAKQCEVLSIRGTCVYV 971

  Fly  1030 LGLIAGTQAGANILFKLNWLSVRHDKNTMWPVHQPED---------------WMSSQYTPVRH-- 1077
            |||||.|:.|.:||...||.:|||.:..:||| .|:|               .::|:.|..||  
Human   972 LGLIAKTKQGCDILKCHNWDAVRHSRKHLWPV-VPDDVEQLCNELSSIPSTLSLNSESTSSRHNS 1035

  Fly  1078 YYEDVPADNMTMMDDYIERFYETG-SDFWHMLADQT-----DASG------------GGGGVAGT 1124
            ..|.||:....:.||   ||..:. |.|:..:.:.|     |.||            ....|...
Human  1036 ESESVPSSMFILEDD---RFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFPFFASSKLVKNR 1097

  Fly  1125 VVG-------MHPIVQDPNATITTTDS------VRTTT---------DDVHPRMLVGVAAKSKTL 1167
            ::.       .|....||.....:::|      :||.|         ||..|     ::...|||
Human  1098 ILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFNHSDDFTP-----ISTVQKTL 1157

  Fly  1168 PEGSNLRQGKHQRSLSESKTTDVIS----LLGSGVGTMSG---------AVLYPTPYQHRIRYNS 1219
            ...::....||   :.::.:|..|.    ......||.:.         .|...|....:||..|
Human  1158 QLETSFMGNKH---IEDTGSTPSIGENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQS 1219

  Fly  1220 C-TDSNTSGVSSCESVTGRTAAAYAAAANELQQFPLSPIPSMSNLL-------ESDELFRRNQLA 1276
            . ||:.|||:||..|...|......|...:.....:|.:.|...:.       :|:.|......:
Human  1220 FNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVSTKTIKTSHYLTPQSNHLSLSKSNS 1284

  Fly  1277 TSMLP-------------------STLSPMA-----------MKGYVQLRSL-RKHSRPVFSESS 1310
            .|::|                   :|:..:|           ..||..|:.| ::...|..|.|.
Human  1285 VSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAFGYATLKRLQQQRMHPSLSHSE 1349

  Fly  1311 AEFYDFAEILDTPEVQMRKLDWTHSHRRLKVRSLDRQLSDVYRRLSADELNVLLPTLNAPKF--- 1372
            |......::|.|..:.|:...:   ..||....:|      :::.....:..|.||:....|   
Human  1350 ALASPAKDVLFTDTITMKANSF---ESRLTPSRID------FKKKHVGGIRSLRPTITNNLFRFM 1405

  Fly  1373 -------LPPNDLKGPC-------------------------YAGICLPKNVLDLFPTRNLSRTY 1405
                   |...||..|.                         |.|:.||.::.|:|..:::. .:
Human  1406 KALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIP-YF 1469

  Fly  1406 VSRDIQDQDIVGI-------------------NLLNTMLRPQCLNDSLTNEGGDESSVISSLSDV 1451
            .:::|...|..|.                   |..:.:.:...|.:.:.:...|.|..:.|..|.
Human  1470 QTKNIPPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTEIMNSIHSDASLFLESTEDT 1534

  Fly  1452 SSASRRQTRQLQQGAKHSRSLCLHC------ARSPRQQRNDSGSHSNGGGGASLAPCELYSSAAA 1510
            .         ||:   |:...||:|      ...|..|.:...|||:    ....|   ||....
Human  1535 G---------LQE---HTDDNCLYCVCIEILGFQPSNQLSAICSHSD----FQDIP---YSDWCE 1580

  Fly  1511 ALVAAGIQAGPVLAKKSGSS--AQGASAALGADISFHSPESMLSEDSLPD-------RLTASILY 1566
            ..:...::..|  :|.||.|  :.|.|.. |:..|..|.|.:|...::||       .|...:|.
Human  1581 QTIHNPLEVVP--SKFSGISGCSDGVSQE-GSASSTKSTELLLGVKTIPDDTPMCRILLRKEVLR 1642

  Fly  1567 NVQRLANPVSAKQSKMALLELKQKHPHAFQDICLYSEACKTIGRSSYRMIARRFLQELFLDLNFD 1631
            .|..|::.||.|..:..||.:|:|:|..|.|||||||....:...::|:..|||:||||.|:.| 
Human  1643 LVINLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDVQF- 1706

  Fly  1632 SFYVEPQLIIGARKFSAEEKAEATAPTAMQAMPFKQTIL 1670
                          ....|:|||...|     |.||.|:
Human  1707 --------------LQMHEEAEAVLAT-----PPKQPIV 1726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rictorNP_573371.1 RICTOR_N 63..440 CDD:291336 139/382 (36%)
RICTOR_M 583..798 CDD:291338 73/222 (33%)
RasGEF_N_2 805..908 CDD:291335 37/105 (35%)
RICTOR_V 977..1047 CDD:291340 26/70 (37%)
RICTORNP_001272368.1 Interaction with NBN. {ECO:0000269|PubMed:23762398} 1..789 275/855 (32%)
RICTOR_N 60..437 CDD:291336 138/380 (36%)
RICTOR_M 525..740 CDD:291338 77/281 (27%)
RasGEF_N_2 747..853 CDD:291335 38/106 (36%)
RICTOR_V 922..989 CDD:291340 26/69 (38%)
RICTOR_phospho 1084..1188 CDD:291337 18/112 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343929499
eggNOG 1 0.900 E1_KOG3694
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 605 1.000 Inparanoid score I921
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003100
OrthoInspector 1 1.000 T1075044
orthoMCL 1 0.900 OOG5_130440
Panther 1 1.100 LDO PTHR13298
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1404
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.