DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and ndst1a

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001311428.1 Gene:ndst1a / 100329944 ZFINID:ZDB-GENE-111012-2 Length:869 Species:Danio rerio


Alignment Length:324 Identity:95/324 - (29%)
Similarity:145/324 - (44%) Gaps:72/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PPAQTVTSSLDGAPKY--------QLLRQQGLRPSRH------------LPDTLIIGVKKSGTRA 146
            ||.|.       |.||        :.|.|......||            .|..|:||.:|:||.|
Zfish   549 PPLQL-------AEKYFHMFPSDTEPLWQDPCEDKRHKDIWSKEKTCDRFPKLLLIGPQKTGTTA 606

  Fly   147 LLEFIRLHPDV------RAAGSEVHFFDRH-YQRGLRWYRHH--MPYTIEGQITMEKTPSYFVTK 202
            |..|:.:|||:      :....|:.||..: ||||:.||..:  :|.....:...||:.:||.:.
Zfish   607 LYLFLGMHPDLTSNYPSKETFEEIQFFSGYNYQRGIDWYMEYFPLPSNSSSEYYFEKSANYFDSD 671

  Fly   203 EVPQRVYHMNPATKLLIVVRDPVTRAISDYTQAASKKADMKLFEQLAFVNG-----SYSVVD--- 259
            ....|...:.|..|::.|:.|||.||.:.|              |...|:|     .||..|   
Zfish   672 VAALRAAALLPRAKIITVLSDPVDRAYAWY--------------QHQRVHGDPVALKYSFHDVIT 722

  Fly   260 -TNWGPVKI----------GVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLK- 312
             ::..||::          |.|:::|.||:.:|..||:|.:.|:.|..|||..:.::|.||||: 
Zfish   723 ASHNAPVRLQTLQKRCLLPGFYSKHLTRWIQHFHHSQILVVDGQTLKTDPASVLEKIQTFLGLEN 787

  Fly   313 RVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQL 376
            ||...|...||..|||.|......::  .|||::||:.:|.:|..:...||.:|...|.:..:|
Zfish   788 RVDYHKILAFNPKKGFWCQLLDGGKT--KCLGRSKGQRYPDMDTQSQVFLRNYYSDGNIELSKL 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 83/265 (31%)
ndst1aNP_001311428.1 HSNSD 27..502 CDD:288882
Sulfotransfer_1 592..839 CDD:279075 82/262 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.