DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-B and XB5817455

DIOPT Version :9

Sequence 1:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001096473.1 Gene:XB5817455 / 100125092 XenbaseID:XB-GENE-5817456 Length:314 Species:Xenopus tropicalis


Alignment Length:262 Identity:108/262 - (41%)
Similarity:166/262 - (63%) Gaps:12/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVHFF--DRHYQRGLRWYRHHMPYTIEGQI 190
            |.|:|.|:|:||:|.|||||||.:.:||::..|.:|||||  |.:|.:|:.|||:.||::.|.||
 Frog    58 SHHIPQTIIVGVRKGGTRALLEMLDIHPNIVVAATEVHFFDWDENYVKGIEWYRNLMPFSYENQI 122

  Fly   191 TMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRAISDYTQA----ASKKADMKLFEQLAFV 251
            |:||||.||.:...|:|::.||.:.||||::|||..|.||||||.    ...:..::.||.:...
 Frog   123 TIEKTPGYFTSLHAPERIHDMNSSIKLLIILRDPTERVISDYTQVYYNRLENRKSVQRFEDIVIK 187

  Fly   252 NGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFISGERLIMDPAYEIGRVQDFLGLKRVVT 316
            ||:   ::|.:..::..:|..::||||.||.|:|:..:.|..||..|..|:.:|:.||.|...:.
 Frog   188 NGA---LNTKYKAIQRSLYDVHMERWLKYFDLNQIHIVDGNTLIKQPLKELQKVEKFLNLPPKIL 249

  Fly   317 EKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHIDPGAIERLREFYRPFNNKFYQLTGINF 381
            ..:||||.||||.|: :|:.|.  .||.::|||.||.::...:|:|..::|..|..||::...:|
 Frog   250 SSNFYFNQTKGFYCI-RSDGRE--RCLHESKGRPHPVVNRTVLEQLYSYFREHNRNFYKMVNQSF 311

  Fly   382 AW 383
            .|
 Frog   312 DW 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 100/242 (41%)
XB5817455NP_001096473.1 Sulfotransfer_1 62..263 CDD:307022 88/203 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.