DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ULP1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_015305.1 Gene:ULP1 SGDID:S000005941 Length:621 Species:Saccharomyces cerevisiae

Alignment Length:650 Identity:156/650 (24%)
Similarity:251/650 (39%) Gaps:150/650 (23%)


  Fly   954 QHRVRNDAPHVP--TPFDDEESSQR-LANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRR 1015
            |:..:|  |:.|  :|........| |.|...|.|..::|        ||.:.|.|         
Yeast    13 QYHKKN--PYSPLFSPISTYRCYPRVLNNPSESRRSASFS--------GIYKKRTN--------- 58

  Fly  1016 EPSRLH----RSILSHEMNCKDQEQ----------YNELIRTQTNYVGSRYLKPGTPPTFQRAKA 1066
             .||.:    |.:||.|.:.||...          ..|.:.....|:...::| ..|..|..::.
Yeast    59 -TSRFNYLNDRRVLSMEESMKDGSDRASKAGFIGGIRETLWNSGKYLWHTFVK-NEPRNFDGSEV 121

  Fly  1067 QSATSSSCSLQDNQSNITDSFPSPHG-RANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSA 1130
            :::.:|....:.:.|..:|   .|:| |.|     |:....:.:.:.:....|.:.:|..|....
Yeast   122 EASGNSDVESRSSGSRSSD---VPYGLREN-----YSSDTRKHKFDTSTWALPNKRRRIESEGVG 178

  Fly  1131 SHASTISSSASSSCSTCSTCSSSDTEPMLVKDS-PEVKEANEANEANEANEANETKEN-DAPQPT 1193
            :.:::..||.:|..|.|    .||......:|. ...|....|..:|..|..::.|.: |..|..
Yeast   179 TPSTSPISSLASQKSNC----DSDNSITFSRDPFGWNKWKTSAIGSNSENNTSDQKNSYDRRQYG 239

  Fly  1194 TTRIKKPDFLHRRFAN-----------CIFLRNDFAENFKA-----RANRRQLESM--------- 1233
            |..|:|.....:...|           ..:||..|...:|.     ....|||:.|         
Yeast   240 TAFIRKKKVAKQNINNTKLVSRAQSEEVTYLRQIFNGEYKVPKILKEERERQLKLMDMDKEKDTG 304

  Fly  1234 ---HLLGIAE--------------QQANESKDERL-AYEKKLREVMFRSGAPHRPF------FEI 1274
               .::.:.|              |..||:.|:.: ..|||:..:..:    |:.:      |:.
Yeast   305 LKKSIIDLTEKIKTILIENNKNRLQTRNENDDDLVFVKEKKISSLERK----HKDYLNQKLKFDR 365

  Fly  1275 GPLE------------------------QPEEKKETKLIP-LTKEDHARFQEMTTIEVTTNLIFK 1314
            ..||                        :.|:..:.||:| |.::|..:.|:.......|.|:.:
Yeast   366 SILEFEKDFKRYNEILNERKKIQEDLKKKKEQLAKKKLVPELNEKDDDQVQKALASRENTQLMNR 430

  Fly  1315 YNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVR 1379
            .|::||..|..|.....||||.||.|:|..: |:|      .|.|.|.|:||...|.:.||.|||
Yeast   431 DNIEITVRDFKTLAPRRWLNDTIIEFFMKYI-EKS------TPNTVAFNSFFYTNLSERGYQGVR 488

  Fly  1380 RW--TRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGR-PNQPA---LDALVKYLH 1438
            ||  .:|..:...|.|..|::....||.:.||.|:.|||.|.||:.. ||..:   |..|.||:.
Yeast   489 RWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVM 553

  Fly  1439 EESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMA 1503
            |||.....:.||:...      :.|:|.|..|||::.||...|.:.|.|:.|...:.:..|..:|
Yeast   554 EESKHTIGEDFDLIHL------DCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIA 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 64/179 (36%)
ULP1NP_015305.1 ULP1 36..621 CDD:227489 150/625 (24%)
Peptidase_C48 447..617 CDD:280975 64/179 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131091067
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T634677
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.740

Return to query results.
Submit another query.