DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ESD4

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_567478.1 Gene:ESD4 AraportID:AT4G15880 Length:489 Species:Arabidopsis thaliana

Alignment Length:381 Identity:107/382 (28%)
Similarity:170/382 (45%) Gaps:66/382 (17%)


  Fly  1162 DSPEVKEANEANEANEANEANETKENDAPQPT----TTRIKKPDFLHRRFANCIFLRNDFAENFK 1222
            :..||...:.:.:|.|..:.::.:|....||:    .|.:||                  .|||:
plant   133 EKEEVVSDDSSVQAIEVIDCDDDEEKKNLQPSFSSGVTDVKK------------------GENFR 179

  Fly  1223 ARANRRQLESMHLLGIAEQQAN---------------ESKDERLAYEKKLREVMFRSGAPHRPFF 1272
            .......|:|:.|....:..|:               .||.|.|.:|..|.|.........||..
plant   180 VEDTSMMLDSLSLDRDVDNDASSLEAYRKLMQSAEKRNSKLEALGFEIVLNEKKLSLLRQSRPKT 244

  Fly  1273 EIGPLEQPEEKKETKLIPLTKEDHA----------RFQEMTTIEVTTNLIFKYNLQITTDDIFTF 1327
            ....:|.|.|    ..||||:::.|          |.:.:.|.|       ..|:.||.:.:...
plant   245 VEKRVEVPRE----PFIPLTEDEEAEVYRAFSGRNRRKVLATHE-------NSNIDITGEVLQCL 298

  Fly  1328 VDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLL-QAGY--AGVRRWT--RKVD- 1386
            ....||||.:||.|:.:|.||..:...:....:..||||..:|: .:||  ..|||||  ||:. 
plant   299 TPSAWLNDEVINVYLELLKERETREPKKYLKCHYFNTFFYKKLVSDSGYNFKAVRRWTTQRKLGY 363

  Fly  1387 -LFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFD 1450
             |...|:|.||:|.| |||.:|:|:.|...:.|.||:...:...|:||.||:.:|:.:|..:..|
plant   364 ALIDCDMIFVPIHRG-VHWTLAVINNRESKLLYLDSLNGVDPMILNALAKYMGDEANEKSGKKID 427

  Fly  1451 MTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEI 1506
            ...:.:|..:::|:|.|..|||:|...:.::.:|.:.:.|||..|.|||.:.|.||
plant   428 ANSWDMEFVEDLPQQKNGYDCGMFMLKYIDFFSRGLGLCFSQEHMPYFRLRTAKEI 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 66/182 (36%)
ESD4NP_567478.1 PLN03189 1..489 CDD:215622 107/382 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoInspector 1 1.000 T32349
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.750 Consistency score
54.920

Return to query results.
Submit another query.