DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ULP1A

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_187347.2 Gene:ULP1A AraportID:AT3G06910 Length:502 Species:Arabidopsis thaliana

Alignment Length:429 Identity:110/430 (26%)
Similarity:181/430 (42%) Gaps:94/430 (22%)


  Fly  1122 KRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKD--------SPEVKEANEANEANEA 1178
            ||||.:||..:                   .:|.|.:.|.|        |.:.......|.|.|.
plant   118 KRNALDSSLRY-------------------RTDREVIDVDDELGDVEMISDDTSREGVENVAMEV 163

  Fly  1179 NEANETKENDAPQPTTTRIKKPDFLHRRFANCIFLRND---FAENFKA----------------- 1223
            :|..|               |.:..:..|:....|:|.   ..|..||                 
plant   164 DEVEE---------------KAEMGNGLFSEVASLKNGSLRVGECSKANSSSLVVNRPVTDVTSF 213

  Fly  1224 RANRRQLESMHLLGIAEQQANESKDERLA-YEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKET- 1286
            .|.|:.|||      |..:.::.||.... :.|:....:.||.:   .|:     .|.||..|. 
plant   214 EAYRKVLES------AVNRTSKLKDRGFVDFFKERGRALLRSLS---SFW-----RQDEEPVEVV 264

  Fly  1287 ---KLIPLTKEDHARFQEMTTIEVTTNLIFKY---NLQITTDDIFTFVDGEWLNDAIINFYMSML 1345
               ..:||::|:....:...:.. .:|::..:   |:.||...:.....|:||||.:||.||.:|
plant   265 QREAFVPLSREEETAVRRAFSAN-DSNILVTHKNSNIDITGKILRCLKPGKWLNDEVINLYMVLL 328

  Fly  1346 TERSEKRAGELPATYAMNTFFMPRLLQA----GYAGVRRWT--RKVDLFSKDI--IPVPVHCGNV 1402
            .||..:...:....:..||||..:|:.:    .|..|||||  :::....||.  |.:|:|. |:
plant   329 KEREAREPKKFLKCHFFNTFFFTKLVNSATGYNYGAVRRWTSMKRLGYHLKDCDKIFIPIHM-NI 392

  Fly  1403 HWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGN 1467
            ||.:|:|:::::...|.||........||||.:|..:|..||.:...|::.:..|..|::|.|.|
plant   393 HWTLAVINIKDQKFQYLDSFKGREPKILDALARYFVDEVRDKSEVDLDVSRWRQEFVQDLPMQRN 457

  Fly  1468 SSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEI 1506
            ..|||:|...:.::.:|.:.:.|:|.:|.|||.:.|.||
plant   458 GFDCGMFMVKYIDFYSRGLDLCFTQEQMPYFRARTAKEI 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 62/183 (34%)
ULP1ANP_187347.2 PLN03189 37..502 CDD:215622 110/430 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoInspector 1 1.000 T32349
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.