DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp3

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001157043.1 Gene:Senp3 MGIID:2158736 Length:568 Species:Mus musculus

Alignment Length:676 Identity:133/677 (20%)
Similarity:230/677 (34%) Gaps:183/677 (27%)


  Fly   868 TGTGFQAQNGKGFGAGRQ----PENSFLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIP 928
            :|.||....|.|.....:    |..||.:.....:||.                 ..|..|::..
Mouse    42 SGGGFGPDPGSGTTVPTRRLPAPRPSFDASASEEEEEE-----------------EEEDEEEVAA 89

  Fly   929 NNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAV 993
            .....:..|..:|:|.....|    .||              :..|||...|..:.:.:.||.:.
Mouse    90 WRLPPRWGQLGASQRSRALRP----SHR--------------KTCSQRRRRAMRAFQMLLYSKST 136

  Fly   994 RLGHNGISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTP 1058
            .|..:.....|..|             .|..|:|..|                     :|.|   
Mouse   137 SLTFHWKLWGRHRG-------------RRRNLAHPKN---------------------HLSP--- 164

  Fly  1059 PTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKR 1123
               |...|.....|.|.          .|.||.|...|.|.....|: .::......|.|..|..
Mouse   165 ---QEGGATPQVPSPCC----------RFDSPRGLPPPRLGLLGALM-AEDGMRGSPPVPSGPPM 215

  Fly  1124 NASNSSASHASTIS-SSASSSCS-------------------------TCSTCSSSDTEPMLVKD 1162
            .......:..|.:. .|...||:                         ..:.||..|      ..
Mouse   216 EEDGLRWTPKSPLDPDSGLLSCTLPNGFGGLSGPEGERSLAPPDASILISNVCSIGD------HV 274

  Fly  1163 SPEVKEANEANEANEANEANETKENDAPQPTTTRIKKPDFLHRRFANCI-FLRNDFAENFKARAN 1226
            :.|:.::::...|.||:...|.....:|            |......|: .:.::|.:.:.:   
Mouse   275 AQELFQSSDLGIAEEADRTGEKAGQHSP------------LREEHVTCVQSILDEFLQTYGS--- 324

  Fly  1227 RRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPL 1291
                    |:.::..:..|          ||.::..:              |.....:::.::.|
Mouse   325 --------LIPLSTDEVVE----------KLEDIFQQ--------------EFSTPSRKSLVLQL 357

  Fly  1292 TKEDHARFQEMTTIEVTTNLIFKYNLQI-TTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGE 1355
            .:.    :|.|....:.......|...: |.||:.|.....||||.::|.|..::.:...::   
Mouse   358 IQS----YQRMPGNAMVRGFRVSYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEK--- 415

  Fly  1356 LPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYD 1420
               .:..|:||..:|...||.||:|||:.||:|:|:::.:|:|. .|||.:..:.:|.:||.|:|
Mouse   416 ---VHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHL-EVHWSLISVDVRRRTITYFD 476

  Fly  1421 SMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRD 1485
            |....|:.....:.|||..|::.|.:..|.. |:......|:.||.|.||||.|...:.:::...
Mouse   477 SQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQ-GWKGYFKMNVARQNNDSDCGAFVLQYCKHLALS 540

  Fly  1486 VPITFSQAEMLYFRTKMALEIADGKL 1511
            .|.:|:|.:|...|.::..|:...||
Mouse   541 QPFSFTQQDMPKLRRQIYKELCHCKL 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 55/175 (31%)
Senp3NP_001157043.1 Nuclear localization signal. {ECO:0000255} 119..122 1/3 (33%)
Nuclear localization signal. {ECO:0000255} 147..153 3/19 (16%)
Protease 380..537 53/165 (32%)
Peptidase_C48 394..566 CDD:280975 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106176912
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.