DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp2

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_008767027.1 Gene:Senp2 RGDID:708378 Length:593 Species:Rattus norvegicus

Alignment Length:685 Identity:176/686 (26%)
Similarity:271/686 (40%) Gaps:195/686 (28%)


  Fly   904 LIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPT-- 966
            |:|.||..:|   |.:.....|.||    |||      .||..|      .|:|:|...:..:  
  Rat    26 LLKRRRSSSS---LFSTAVDTDEIP----AKR------PRLDCF------IHQVKNSLYNAASLF 71

  Fly   967 --PFD------DEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRV-------NGHSSH----- 1011
              ||.      ...:.....|..||....:.|.:..|..:|...|.:       ||.|.:     
  Rat    72 GFPFQLTTKPMVSSACNGTRNVAPSGEVFSNSPSCELTTSGSCSSMLKLGNKSPNGISDYPKIRV 136

  Fly  1012 TVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSATSSSCSL 1076
            ||.|:..|  |.:.|.....| .|.||.              :|.     .|..::|...||...
  Rat   137 TVARDQPR--RVLPSFGFTLK-SEGYNR--------------RPS-----GRRHSKSNPESSLPW 179

  Fly  1077 QDNQSNITDSFPS--------PH-----GRANPELTEYAKLINRQENEENRSPAPQQPKRNASNS 1128
            :..:..:|:....        ||     |....|..:|.||:.|.:                   
  Rat   180 KPQEQGVTEMISEEGGKGARRPHCTVEEGVQKDEREKYLKLLERLK------------------- 225

  Fly  1129 SASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANE---------------- 1177
            ..:|.||...:.|..       ||..|:...:|....::|.|.......                
  Rat   226 EGAHGSTFPPAVSHH-------SSQRTQMDTLKTKGWMEEQNHGVRTTHLVPKQYRVVETRGPLC 283

  Fly  1178 --ANEANETK-ENDAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARAN---------RRQL 1230
              .:|...:| :.|..:....|.:|......:      |..|.:|...||..         ||::
  Rat   284 SVRSEKRYSKGKADTEKVVGLRFEKDGTRGHQ------LEPDLSEEVSARLRLGSGSNGLLRRKI 342

  Fly  1231 ESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKED 1295
            ..:           |:|::....::|                         :::...|..||  :
  Rat   343 SVL-----------EAKEKNFPSKEK-------------------------DRRTEDLFELT--E 369

  Fly  1296 HARFQEMTTIEVTTNL-----------IFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERS 1349
            |...|:|.. |::..|           .||  |:||..||.|..:..||||.:|||||::|.|||
  Rat   370 HRLIQDMEK-EISNALGHGPPDEILSSAFK--LRITRGDIQTLKNYHWLNDEVINFYMNLLVERS 431

  Fly  1350 EKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNK 1414
            :|:.  .||.:|::|||.|:|...||..|:|||:.|:||.::::.||:| ..|||.:.::.||.|
  Rat   432 KKQG--YPALHALSTFFYPKLKSGGYQAVKRWTKGVNLFDQELVLVPIH-RKVHWSLVVMDLRKK 493

  Fly  1415 TIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDM---TGFVVENAQNIPRQGNSSDCGVFSC 1476
            .:.|.||||:......:.|::||.:||..||....::   |.:.:: ...||:|.|.||||:|:|
  Rat   494 CLKYLDSMGQKGHRICEILLQYLQDESKTKRNTDLNLLEWTHYSMK-PHEIPQQLNGSDCGMFTC 557

  Fly  1477 MFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            .:|:||:||.||||:|.:|..||.||..||...:|
  Rat   558 KYADYISRDKPITFTQHQMPLFRKKMVWEILHQQL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 79/178 (44%)
Senp2XP_008767027.1 Peptidase_C48 <372..588 CDD:304959 92/223 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T131225
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.970

Return to query results.
Submit another query.