DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and LOC683408

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_006225127.1 Gene:LOC683408 RGDID:1586882 Length:476 Species:Rattus norvegicus

Alignment Length:530 Identity:141/531 (27%)
Similarity:219/531 (41%) Gaps:109/531 (21%)


  Fly   999 GISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQR 1063
            |..: |.....:..|.:||.:..:         |..::|.:|                   .|||
  Rat    38 GQGQXRKCQDGTEMVFKEPGKALK---------KTPQEYQDL-------------------AFQR 74

  Fly  1064 ---AKAQSATSSSCSLQDNQSNITD-SFPSPHGRANPELTEYAKLINRQEN-EENRSPAPQQPKR 1123
               .|||..|    .|:|....:.. .:|. ......:.|:..|...|:.: .|.:.. ||:.|.
  Rat    75 EQPGKAQGQT----PLEDGSRKLNPLEYPPXQAITEKKFTDSGKDRKRRYSFLEEKDQXPQKEKY 135

  Fly  1124 NASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKEND 1188
            ..|.. ......:.|....            ..| |. |:.:.|.....:.     ..:||.:.|
  Rat   136 EKSLQXLQCGHPVRSYPHR------------PHPXLY-DTLKNKRGRSGHP-----HGSETVQRD 182

  Fly  1189 APQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARANRRQ-----LESMHLLGIAEQQANESKD 1248
            . :|:|..:            |...... ||... |.|..:     .|:.::|.....:...:|.
  Rat   183 R-EPSTEVL------------CTKSEKRXAEEKSXRGNSLEPGLPGTENANILTSGRGRLLPNKL 234

  Fly  1249 ERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIF 1313
            ..|..|||                   ||...|:.:|   |.:|.|.....::.........::.
  Rat   235 PVLVAEKK-------------------PLTDQEKNRE---IEVTHEMEKEIKKGLCPGPQNEIMS 277

  Fly  1314 K-YNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAG 1377
            . :.||||..||.|..:|:||||.:|||||::..:|::.:.  .||.:|.:|||.|:|...||..
  Rat   278 SGFKLQITKGDIQTLKNGQWLNDEVINFYMNLPVQRNQNQG--YPALHAFSTFFYPKLKHGGYNF 340

  Fly  1378 VRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESL 1442
            |::|||.:::|.|::|.||:| ..|||.:.:|.||.::|.|.||||:..:...:.:..||..||.
  Rat   341 VKKWTRGINIFEKELILVPIH-QRVHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQNESK 404

  Fly  1443 DKRKQPFDMTGFVVE------NAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTK 1501
            .:|....|    .||      .:|.||:|.|.||||:|:|.:|:||:||.|:||||..|..||.:
  Rat   405 TRRNMELD----PVEWKQYSLTSQEIPQQLNGSDCGMFTCKYADYISRDQPVTFSQQHMPLFRKR 465

  Fly  1502 MALEIADGKL 1511
            |..||....|
  Rat   466 MVWEILHSHL 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 76/181 (42%)
LOC683408XP_006225127.1 Peptidase_C48 296..475 CDD:280975 77/186 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.