DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and RGD1564247

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_003749289.1 Gene:RGD1564247 RGDID:1564247 Length:750 Species:Rattus norvegicus

Alignment Length:642 Identity:145/643 (23%)
Similarity:240/643 (37%) Gaps:156/643 (24%)


  Fly   890 FLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNN------SMAKRDQPQSSKRLSIFN 948
            |.||..|.:.   |:.|.|:...|:.:.:|.:..|:...||      |.|...:|:...|...:.
  Rat   243 FRSQHFRTKS---RVCKLRKAQRSWVQKVTGDHQENFRDNNTEGGDCSPAPSLEPKDLCRCQPYF 304

  Fly   949 PPVYTQHRVRNDAPHVP------TPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNG 1007
            |.:.:...|:....|||      :|..|:|..  |..|.|..:                    ||
  Rat   305 PDMDSSAVVKGKNCHVPDGHTKESPALDKEHG--LDAAFPDQQ--------------------NG 347

  Fly  1008 HSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSATS- 1071
            .:::|..:..|       |.:..|  .||.:|:  ....:..|....|||.........:|.|| 
  Rat   348 STTYTWDQPSS-------SPKWEC--TEQIHEI--PLMGHPSSDNFTPGTERALMTLGQESRTSA 401

  Fly  1072 -SSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHAST 1135
             |...::.:.|...:|..|..|                       |..::|.:|.:.......|.
  Rat   402 VSDDGVKLSVSGADESVSSVDG-----------------------PVSEEPAQNENFQMEEDGSL 443

  Fly  1136 ISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRIKKP 1200
            ..:..||.......|.|    |:   |:|.|     .:|....|:....|......|..      
  Rat   444 RQNILSSKLLDHPYCKS----PL---DAPLV-----CSELKVENQVAGGKSGQTASPVD------ 490

  Fly  1201 DFLHRRFANCI--FLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFR 1263
               ..:.:.|:  ||    .|..|...:...|....:||                  :|::|...
  Rat   491 ---DEQLSTCLSGFL----DEVMKKYGSLVPLSEKDVLG------------------RLKDVFNE 530

  Fly  1264 SGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEV---TTNLIFKYNLQITTDDIF 1325
            ..:..:||..                          :|:|...|   ..|. ..||..:...|..
  Rat   531 DFSNRKPFIN--------------------------REITNYRVRHQKCNFXIFYNKHMLDMDDL 569

  Fly  1326 TFVDGE-WLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFS 1389
            ..:||: ||||.:||.|..::.:....:      .:..|:||..:|:..||.||:|||:|||||.
  Rat   570 ATLDGQNWLNDQVINMYGELIMDAVPDK------VHFFNSFFHRQLVTKGYNGVKRWTKKVDLFK 628

  Fly  1390 KDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGF 1454
            |.::.:|:|. .|||.:..:.|.::.|.:|||.|...:..::.:.|||..|:.:|.:..| :.|:
  Rat   629 KSLLLIPIHL-EVHWSLITVTLSSRIISFYDSQGIHFKFCVENIRKYLLTEAREKNRPEF-LQGW 691

  Fly  1455 VVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            .....:.||:|.|.||||||...:.:.:..:.|..|||.:|.. |.::..|:.:.:|
  Rat   692 QTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRXRKRIYKELCECRL 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 59/176 (34%)
RGD1564247XP_003749289.1 HDPD 116..>165 CDD:280992
Peptidase_C48 576..748 CDD:280975 59/180 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.