DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp7

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_079759.2 Gene:Senp7 MGIID:1913565 Length:1037 Species:Mus musculus

Alignment Length:1007 Identity:190/1008 (19%)
Similarity:305/1008 (30%) Gaps:431/1008 (43%)


  Fly   825 PPRPTPKRDLQEDISMGLEILKKIRGMLSG--WYSSRESETDSTDTGTGFQAQNGKGFGAGRQPE 887
            ||:..|||.|              |.||:.  |          ||.|..|:              
Mouse    82 PPKGLPKRHL--------------RVMLTNVLW----------TDLGREFR-------------- 108

  Fly   888 NSFLSQKRRNQEENPRLIKYRRVDNSFPRLITN-----ETAEDLIPNNSMAKRDQPQSSKRLSIF 947
                                    .:.||...|     :...|.:|:.|:   |..::.:||.  
Mouse   109 ------------------------KTLPRKDANLCAPSKVQSDSLPSTSV---DSIETCQRLD-- 144

  Fly   948 NPPVYTQHRVRNDAPHV-PTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISES-------- 1003
              |::....:....|.| .|.....|..::.....|.:. .:.||...|....:|.|        
Mouse   145 --PLHQSLNLSERTPRVILTDIRQTELGRKYLKIPPVTE-ASLSDTANLKSEQLSSSSDGSLESC 206

  Fly  1004 -RVNGHSSHTVRR--EPSRLHRSILSHEMNCKDQEQYNELIRT-----------QTNYVGSRYLK 1054
             .||.|.|.....  :|||. ..:.:.|..|..|:|.::...|           .|...|..||:
Mouse   207 QSVNHHKSFLSESGPKPSRT-GDVPAKEAACGGQKQGDDGGVTPEMAAPHPKDFNTGNKGCDYLE 270

  Fly  1055 PGTPPTFQRAKAQSATSSSCSLQDN-----------QSNITDSF--------PSPHGRANPELTE 1100
            .||        :...||.|.|..|:           :||..||.        |:.|.:.....:.
Mouse   271 EGT--------SNKNTSYSYSEMDHTPVSRKRKKRGRSNFHDSHNSKTSLDKPTEHTKEEENDSS 327

  Fly  1101 YAKLINRQENEENRSPAP----------------------QQPKRNASNSSASHAS-TISSSASS 1142
            .::.:.....:.::.|||                      |:|..:|::..||..: ::.|||||
Mouse   328 VSRKLEESGEDSHQDPAPPEGLAPESLESEATNLRSFAAGQEPDASAASGRASSPNKSLESSASS 392

  Fly  1143 SCSTCSTCS----------------SSDTEPMLVKDSPEVKEANEANEANEANEA---------- 1181
            ..|..|:.:                ||:...:|:...|.|..::|.......|..          
Mouse   393 EVSENSSVAVKGEALTLKEASPPGGSSEESQLLISAEPIVVSSDEEGPVEHKNSVILKLQPPHEI 457

  Fly  1182 -NETKENDAPQ----------------------PTTTRIK----------KPDFL---------- 1203
             :|.:....||                      |....|.          |.||:          
Mouse   458 MSENQGTSDPQLSELTLGACESVQVTSELFPYNPDVENISCIKSNSEMDLKLDFIFTCVYIGKIK 522

  Fly  1204 ----------------------------------------------HRRFANCI---FLRNDFAE 1219
                                                          |.:.::.|   :|.:|:.:
Mouse   523 GTPKGCVTFTKKYIKIPFQVSTNEISLTVDTARLKRFGLWESKDEDHSKRSHAILFLWLSSDYLQ 587

  Fly  1220 NFKARANRRQLESMHLLGIAEQQANE----------SKDERLAYEKKLREVMFRSGAPH----RP 1270
            :.:.     |||:..|  ..:.:|||          |:.|.|..:..:.|:..::|..|    .|
Mouse   588 DIQT-----QLENPML--SQQSKANEFIFLELNSSISQREELKLKDIMMEISTKNGNLHLSCPLP 645

  Fly  1271 FFEIGPLEQ---PEE----------------------KKETKLIP-------------------- 1290
            :.:..||.|   |:|                      ||::...|                    
Mouse   646 WVQALPLFQDLSPQEISFLHYYYASASALPTAAGADMKKKSVSQPSNSDTIKPTYTFLHKQSSGC 710

  Fly  1291 ----LTKEDHARFQEMTTIEVTTNLIF------KYNLQITTDDIFTFVDGEWLNDAIINFYMSML 1345
                :|......:||:........||.      |..|.:|.:|:....:||:|||.||:||:..|
Mouse   711 YSLSITSSPEEEWQEVRNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYL 775

  Fly  1346 TERSEKRAGEL-PATYAMNTFFMPRL----------------LQAGYAGVRRWTRKVDLFSKDII 1393
            .  .||.:.|| ..::..::||...|                .|..:..||.|||.:::|:||.|
Mouse   776 L--LEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYI 838

  Fly  1394 PVPVHCGNVHWCMAII---------------------------HLRNKT---------------- 1415
            .|||: .:.||.:|:|                           |....|                
Mouse   839 FVPVN-ESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAED 902

  Fly  1416 -------------------IFYYDSMGRPN-QPALDALVKYLHEESLDKRK--QPFDMTGFVVEN 1458
                               |...||:...: |..:..|.:||..|...|||  :.|..|. :|:.
Mouse   903 SQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHREFSKTN-MVDL 966

  Fly  1459 AQNIPRQGNSSDCGVFSCMFAEYITRDVPITF 1490
            ...:|:|.|||||||:...:.|...:|..:.|
Mouse   967 CPKVPKQDNSSDCGVYLLQYVESFFQDPIVNF 998

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 61/243 (25%)
Senp7NP_079759.2 Protease. {ECO:0000250} 747..1037 65/257 (25%)
Peptidase_C48 761..998 CDD:304959 60/241 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.