DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and SENP2

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_067640.2 Gene:SENP2 HGNCID:23116 Length:589 Species:Homo sapiens

Alignment Length:695 Identity:175/696 (25%)
Similarity:268/696 (39%) Gaps:219/696 (31%)


  Fly   904 LIKYRRVDNS-FPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPT- 966
            |:|.||.|:: |..:.|:|     ||    |||      .||..|      .|:|:|...:..: 
Human    26 LLKRRRSDSTLFSTVDTDE-----IP----AKR------PRLDCF------IHQVKNSLYNAASL 69

  Fly   967 ---PFD------------------------DEESSQRLANAGPSSRPMTYSDAVRLGH---NGIS 1001
               ||.                        ...||..|..:|      ::::.::||:   ||||
Human    70 FGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSG------SWNNMLKLGNKSPNGIS 128

  Fly  1002 E---SRVNGHSSHTVRREPSRLHRSI---LSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPT 1060
            :   .||.     ..|.:|.|:..|.   |:.| .|..:.             |.|....|.|.:
Human   129 DYPKIRVT-----VTRDQPRRVLPSFGFTLNSE-GCNRRP-------------GGRRHSKGNPES 174

  Fly  1061 FQRAKAQSATSSSCSLQDNQSNITDSFPSPH-----GRANPELTEYAKLINR-QENEENRSPAPQ 1119
            ....|.|....:....:::...:.    .||     |....|..:|.||:.| :|:....|..| 
Human   175 SLMWKPQEQAVTEMISEESGKGLR----RPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCP- 234

  Fly  1120 QPKRNASNSSASHASTISS-------------------------SASSSCS-----TCSTCSSSD 1154
             ...|..:|..|...|:.:                         :....||     .||....:|
Human   235 -VTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITD 298

  Fly  1155 TEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRI-----------KKPDFLHRRFA 1208
            ||.|:     .::..||:....:.       |.|..:..:.|:           :|...:..:..
Human   299 TETMV-----GIRFENESRRGYQL-------EPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEK 351

  Fly  1209 NCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFE 1273
            ||             ....|...:..||.:.|..           ||::...:     .|.|..|
Human   352 NC-------------SGKERDRRTDDLLELTEDM-----------EKEISNAL-----GHGPQDE 387

  Fly  1274 IGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAII 1338
            |                                    |...:.|:||..||.|..:..||||.:|
Human   388 I------------------------------------LSSAFKLRITRGDIQTLKNYHWLNDEVI 416

  Fly  1339 NFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVH 1403
            ||||::|.||::|:.  .||.:..:|||.|:|...||..|:|||:.|:||.::||.||:| ..||
Human   417 NFYMNLLVERNKKQG--YPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIH-RKVH 478

  Fly  1404 WCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQ--NIPRQG 1466
            |.:.:|.||.|.:.|.||||:......:.|::||.:||..||....::..:...:.:  .||:|.
Human   479 WSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQL 543

  Fly  1467 NSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            |.||||:|:|.:|:||:||.||||:|.:|..||.||..||...:|
Human   544 NGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQL 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 79/177 (45%)
SENP2NP_067640.2 Nuclear localization signal. {ECO:0000269|PubMed:16738331} 28..31 2/3 (67%)
Nuclear localization signal. {ECO:0000269|PubMed:16738331} 46..51 4/15 (27%)
Nuclear export signal 317..332 3/22 (14%)
ULP1 <384..589 CDD:227489 91/245 (37%)
Protease 396..560 71/167 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130206
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.636 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.