DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and SENP7

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_011511340.1 Gene:SENP7 HGNCID:30402 Length:1051 Species:Homo sapiens

Alignment Length:1104 Identity:210/1105 (19%)
Similarity:353/1105 (32%) Gaps:409/1105 (37%)


  Fly   689 VNEGQRDRELVSYTGHEHQNFVDEVSTPLPPAEAQPGSTSED--ISDPV----SPEHW------- 740
            :.||:|.:.                |:.|........:..||  :..|:    |.|.|       
Human    16 ITEGKRKKS----------------SSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQVW 64

  Fly   741 -----EQLESLDPSTICIRKTFNLIRDISESLVADPEQP---------EAEAHRKSIFLLRQKLA 791
                 .::.|||      .|....||....:..:.||:.         ..:..||....|.:..|
Human    65 ERSLRNKVISLD------HKNKKHIRGCPVTSKSSPERQLKVMLTNVLWTDLGRKFRKTLPRNDA 123

  Fly   792 DVC--HKVLTEIIHGRATDEI-----ISILREILEQTKEIPPRPTPKRDLQEDISMGLEILKK-I 848
            ::|  :||.::.:...:.|.:     :..||:.|..::.||      |.:..:: :|.|:.:| |
Human   124 NLCDANKVQSDSLPSTSVDSLETCQKLEPLRQSLNLSERIP------RVILTNV-LGTELGRKYI 181

  Fly   849 R------GMLSGWYSSRESETDSTDTGTGFQAQN----------GKGFGAGRQPENSFLSQKRRN 897
            |      |.||...:.:..:..|:..|:....||          .:|....:..:::...|...|
Human   182 RTPPVTEGSLSDTDNLQSEQLSSSSDGSLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHN 246

  Fly   898 QEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPV-YTQHRVRNDA 961
            :|:       ||.|:....||::...|||  |:.....|..:...|    |..| |:..:|.   
Human   247 KEK-------RRKDDGISLLISDTQPEDL--NSGSRGCDHLEQESR----NKDVKYSDSKVE--- 295

  Fly   962 PHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREPSRLHRSILS 1026
                ......::.:||.|..|.|:..|..|.               .:..|.::|..    |.:|
Human   296 ----LTLISRKTKRRLRNNLPDSQYCTSLDK---------------STEQTKKQEDD----STIS 337

  Fly  1027 HEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPH 1091
            .|.. |..|.|::              .|..|........:|..:...||...:..::::..|..
Human   338 TEFE-KPSENYHQ--------------DPKLPEEITTKPTKSDFTKLSSLNSQELTLSNATKSAS 387

  Fly  1092 GRANPELTE---------YAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTC 1147
            ..:..|..|         .:.|:.:.|||.|....|.....|..|.|...|..|           
Human   388 AGSTTETVENSNSIDIVGISSLVEKDENELNTIEKPILRGHNEGNQSLISAEPI----------- 441

  Fly  1148 STCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKEN---DAP------------------- 1190
              ..|||.|..:...|.|:.:.....:....||...|.|:   :.|                   
Human   442 --VVSSDEEGPVEHKSSEILKLQSKQDRETTNENESTSESALLELPLITCESVQMSSELCPYNPV 504

  Fly  1191 -------QPTTTRIKKPDFLHRRF---------ANCIFLRNDFAE-NFKARANRRQL--ESMHL- 1235
                   .|:.....:.||:....         ..|:.:...:.: .|:...|...|  ::.|| 
Human   505 MENISSIMPSNEMDLQLDFIFTSVYIGKIKGASKGCVTITKKYIKIPFQVSLNEISLLVDTTHLK 569

  Fly  1236 -LGIAEQQANESKDERLAYEKKLREVMF----------------------RSGAPHRPFFEI-GP 1276
             .|:.     :|||:.  :.|:...::|                      :|.:....|.|: .|
Human   570 RFGLW-----KSKDDN--HSKRSHAILFFWVSSDYLQEIQTQLEHSVLSQQSKSSEFIFLELHNP 627

  Fly  1277 LEQPEEKK------ETKLI----------------PL-----TKEDH----------------AR 1298
            :.|.||.|      |..:|                ||     :||..                |.
Human   628 VSQREELKLKDIMTEISIISGELELSYPLSWVQAFPLFQNLSSKESSFIHYYCVSTCSFPAGVAV 692

  Fly  1299 FQEMT----------------------------TIEVTTN-----------------LIF----- 1313
            .:||.                            ::.:|:|                 :::     
Human   693 AEEMKLKSVSQPSNTDAAKPTYTFLQKQSSGCYSLSITSNPDEEWREVRHTGLVQKLIVYPPPPT 757

  Fly  1314 KYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGEL-PATYAMNTFFM---------- 1367
            |..|.:|.:|:....:||:|||.||:||:..|.  .||.:.|| ..::..::||.          
Human   758 KGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLI--LEKASDELVERSHIFSSFFYKCLTRKENNL 820

  Fly  1368 ----PRL--LQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII----------------- 1409
                |.|  .|..:..||.|||.:::|:||.|.|||: .:.||.:|:|                 
Human   821 TEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVN-ESSHWYLAVICFPWLEEAVYEDFPQTV 884

  Fly  1410 ---------HLRNKT------------------------------------IFYYDSMGRPN-QP 1428
                     ...|||                                    |...||:...: |.
Human   885 SQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQN 949

  Fly  1429 ALDALVKYLHEESLDKRK--QPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITF 1490
            .:..|.:||..|...|.|  :.|..|. :|:....:|:|.|||||||:...:.|...:|..:.|
Human   950 TVQNLREYLEVEWEVKLKTHRQFSKTN-MVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNF 1012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 62/243 (26%)
SENP7XP_011511340.1 Peptidase_C48 775..1012 CDD:304959 61/241 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.