DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and si:dkey-100n23.3

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_005167827.1 Gene:si:dkey-100n23.3 ZFINID:ZDB-GENE-070912-345 Length:991 Species:Danio rerio

Alignment Length:1057 Identity:208/1058 (20%)
Similarity:328/1058 (31%) Gaps:383/1058 (36%)


  Fly   719 PAEAQPGSTSEDISDPVSPEHWEQLESLDPSTICIRKTFNLIRDISESLVADPEQPEAEAHRKSI 783
            |.|.:..||..|.|: ::||....| .|.|         .:.||..::     |.|...|.|.| 
Zfish     2 PDERKHNSTLSDSSN-ITPERRRAL-ILSP---------EIKRDSRQT-----ECPYKIARRGS- 49

  Fly   784 FLLRQKLADVCHKVLTEIIHGRATDEIISILREILEQT-KEIPPRPTPKRDLQEDISMGLEILKK 847
                 ...|.|  |.||:...|.::..|...:.....| .::.|:.| |:..||     |.||:|
Zfish    50 -----AAEDEC--VETEMSKDRKSNNKIHWTQLASNGTSSQLSPKST-KKSNQE-----LTILQK 101

  Fly   848 I-----RGMLSGWYSSRESETDSTDTGTGFQAQNGKGFGAGRQPENSFLSQKRRNQEENPRLIKY 907
            |     :.:|        .:...|:.|......:|..|    |..|...|:||.:|...|.|   
Zfish   102 IHRNQVKVVL--------EDVLLTELGQSLLRCSGHTF----QKTNQSESKKRSDQTSTPTL--- 151

  Fly   908 RRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTPFDDE- 971
                       .|:|      ..|:.||.:..|::                   |...:||.:. 
Zfish   152 -----------KNKT------RTSLTKRGETNSTE-------------------PKATSPFHNNI 180

  Fly   972 ESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREPSRLHRSILSHEMN----CK 1032
            ||..:..|   ||:.:..|.  .|..|..|........:..:.:| |.:..|..|.|.|    .:
Zfish   181 ESKSKSLN---SSQKLLESS--ELSSNSRSPRESESPQAALISKE-SPIQTSSSSFEENEVTLIE 239

  Fly  1033 DQEQYNELIRTQTNYVGSRYLKPGTP-PTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANP 1096
            ...|..|::    :.|....:...:| .|.:|.:.:.|.|   .|..|:....:|..||...|..
Zfish   240 GSLQNEEVL----SAVCESVISSSSPVETRRRPREKKADS---ELLSNKKERRESQESPKDAAKH 297

  Fly  1097 E---LTEYAKLINRQENEENRSPAP--------QQPKRNASNSSAS----------------HAS 1134
            |   |....:|:  ||.|..|....        |.|.:.....|.|                .:.
Zfish   298 EENHLCSNGELV--QEVEGMRGSVLRLSAGTDFQIPVKRCRLDSLSEDQLLNSDLAFDTAEIRSF 360

  Fly  1135 TISSSASSSCSTCSTCSSSDTE----------------PMLVKDSPEVKEANEANEANEANEAN- 1182
            |:.||..|...|....|..:.|                |...||:..|.|:....|..::.|:| 
Zfish   361 TLESSNFSQDETIVLSSEEEDEGEGREETKISALNIQPPEGTKDTNVVDESTTVYEQTKSPESNL 425

  Fly  1183 ------ETKENDAPQPTTTRIKKPDFLHRRFANC----IFLRNDFAENFKARANRRQL------- 1230
                  |.:....|.|.::       ||....:.    |.:...:...|..:.|....       
Zfish   426 SITEMSEEESQGIPLPLSS-------LHMGGVSAKSSGIMMITPYKITFSLKGNSSDSTVKISLS 483

  Fly  1231 ----------------------------ESMHLLGIAEQQANESKDERLAYEKKLRE-------- 1259
                                        .|:..|.:::.||::..|:....|...|.        
Zfish   484 AINVYKYSLWEEHTLWGCDLDKDNEATPTSLLFLWLSDAQAHKLHDDLSVLELGTRPAESSTCLL 548

  Fly  1260 ---------------------VMFRSGAPH---RPFFEIGPLEQPEEKKETKLIPL--TKEDH-- 1296
                                 |:...|:|.   ....:...|...:..:||.|:.|  .|.|.  
Zfish   549 LCMAEPLSGIESALLCSLLDIVVSNQGSPELYCTCLTQSDSLNLLQSSEETHLLQLLTPKPDEQT 613

  Fly  1297 ---ARFQEM-TTIEVTTNLIFK-----YN----------------------------------LQ 1318
               |:.|:. ..:|.|..|..:     ||                                  |.
Zfish   614 STSAQSQDSDVQLEPTYTLCHRRAQGSYNVFLAATPGAEWTPYKHCGPTRRLIQFPPPPSKGALT 678

  Fly  1319 ITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAG------ 1377
            :||:|:.....||:|||.||:||:..|..:...:| .:..::..::||..:|.:...|.      
Zfish   679 VTTEDLECLDSGEFLNDVIIDFYLKYLLVQKAPQA-SVARSHIFSSFFYKQLTRRDNANEDSTST 742

  Fly  1378 ---------VRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII------------------------ 1409
                     ||.|||.||:|.||.:.|||: ...||.:.:|                        
Zfish   743 PAQVRRHQRVRTWTRHVDIFEKDFLFVPVN-QEAHWYLVVICFPGLEDPQYVKRDDSASVQGNGG 806

  Fly  1410 -------------H------------------------------------LRNKTIFYYDSMGRP 1425
                         |                                    |:...|...||:...
Zfish   807 EDVGESENETQGDHRSNSDEDKSTDDSRIKSSTSLRQPDCTENTCKKDVVLKRPCILIMDSLKLS 871

  Fly  1426 -NQPALDALVKYLHEESLDKRKQPFDMTG-FVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPI 1488
             ::.....|.:||..|...||....|.:. .:|.:...:|.|.||||||::...:||        
Zfish   872 IHERIFKLLREYLQVEWETKRMGTRDFSAERMVGSHCKVPLQDNSSDCGLYLLQYAE-------- 928

  Fly  1489 TFSQAEMLYFRTKMALE 1505
            :|.|..:::|...:.||
Zfish   929 SFLQDPVVHFDLPLRLE 945

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 58/266 (22%)
si:dkey-100n23.3XP_005167827.1 ULP1 <678..939 CDD:227489 60/271 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.