DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and senp5

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001073666.2 Gene:senp5 ZFINID:ZDB-GENE-050208-772 Length:487 Species:Danio rerio

Alignment Length:578 Identity:137/579 (24%)
Similarity:232/579 (40%) Gaps:133/579 (23%)


  Fly   964 VPTP--FDDEES-SQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREPSRLHRSIL 1025
            ||.|  .|..|| |.::...|.|.|..........|.||  :..:.||..  |.::..|..:.::
Zfish     3 VPAPNSSDQAESGSGKMPENGRSRRKRVPKTCDCCGPNG--KPHMPGHEQ--VSKKRGRKKKEMV 63

  Fly  1026 SHEMNCKDQE---QYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSATSSSCSLQDNQSNITDSF 1087
            |......::|   ..:.::..:.:.|.:...:  ||..  |.||....|.|         ::||.
Zfish    64 SQGEVAAEEEVVWSTSGVLTLEADAVTAEMEE--TPDA--RGKADFIQSES---------VSDST 115

  Fly  1088 PSPHG---RANPELTEYAKLINRQENEENRSPAP----------QQPKRNAS----NSSASHAST 1135
            ...:|   .|:...|:.||        ||..|..          ::|..:||    ..::.|::.
Zfish   116 VMVNGLENSAHDNCTDPAK--------ENSHPVQAASALLNDLMKKPSDSASVAAEPDASPHSNA 172

  Fly  1136 ISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRIKKP 1200
            :.:..||.|......|..                :...::|.|...:::.|...|.|.       
Zfish   173 METEPSSLCVRVDKASWD----------------HHYCKSNPAENRSDSAEASGPPPA------- 214

  Fly  1201 DFLHRRFANCIFLRNDFAENFKAR-------ANRRQLESMHLLGIAEQQANESKDERLAYEKKLR 1258
            :|......:||   ::|.|.|..:       .....|:  ||..|.:...|:......|...|  
Zfish   215 EFTSEGIIDCI---HEFLEQFYGKYGSFTPLCETDVLD--HLNKIFQADLNDRMKLITAEVAK-- 272

  Fly  1259 EVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDD 1323
               :|:|....|..                                ::||.|   |:.|.:  :|
Zfish   273 ---YRAGLACAPMH--------------------------------LQVTYN---KHTLSL--ED 297

  Fly  1324 IFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLF 1388
            :.|..|..|:||.:||.|..::.|.:..      ..:..|:||..:.:..||.||||||:|||||
Zfish   298 LSTLDDQNWVNDQVINMYGELIMEATNH------TVHFFNSFFYRQFVAKGYEGVRRWTKKVDLF 356

  Fly  1389 SKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTG 1453
            ||.:|.:|:|. .:||.:..:.:..:.|.:|||.|...:.|||.::||:.||:.:| |||....|
Zfish   357 SKTLILIPLHL-EIHWSLITVDVSKQNINFYDSQGILFKFALDNVMKYIMEEAKEK-KQPLFQKG 419

  Fly  1454 FVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            :.:...:.||:|.|.:|||.|...:.:.:....|::|:|.:|...|.::..|:.|.:|
Zfish   420 WKMLINKTIPQQKNDNDCGAFVLEYCKCLAFMKPLSFTQEDMPRVRKRIYRELCDCRL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 61/175 (35%)
senp5NP_001073666.2 Peptidase_C48 305..477 CDD:280975 62/180 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106174669
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.