DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and senp3b

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001077311.1 Gene:senp3b ZFINID:ZDB-GENE-030131-6714 Length:515 Species:Danio rerio

Alignment Length:560 Identity:127/561 (23%)
Similarity:212/561 (38%) Gaps:143/561 (25%)


  Fly  1048 VGSRYLKPGTPPTFQRAKAQSATSSSCSLQDNQSNI-TDSFPSPHGRANPELTEYAKLINRQENE 1111
            :|...:.|.:||        :|||.......|:..: ::.:..|     .||.|.|..   .|||
Zfish     1 MGGGLMDPNSPP--------NATSPIHLKLSNRERVWSEDYIEP-----VELDEEAGF---DENE 49

  Fly  1112 ENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEAN------ 1170
            ::.....::.:....          .....|.|:........:...|..:..|.|..||      
Zfish    50 DDMEEDEEEDEEERD----------EEDIDSECAPWEEKDDLEDWQMPFESQPHVMLANTYQQQV 104

  Fly  1171 EANEANEANEANETKENDAPQPTTTRIKKPDFLH----------RRFANCIFLRNDFAENFKA-- 1223
            ...|....::|.:..||    |...|      ||          ||..:...|||...:|:|.  
Zfish   105 TLTEGEAKSQARDFSEN----PFQMR------LHGLRQQRLNRWRRLRSSARLRNRLVQNWKTWR 159

  Fly  1224 ------------RANRRQLESMH---------------LLGIAEQQANESKDERLAYE------- 1254
                        ||.|.:..|::               |.|:......|::::..||.       
Zfish   160 QQAQWVGTLGYRRARRWRQYSLYASKKREKGCDTKGSTLRGLVTTSERETENQFSAYNGYGDSQS 224

  Fly  1255 ----KKLREVMFRSGAPHRPFFE-------------IGPLEQPEEKKETKLIPLTKEDHAR---- 1298
                ..:||.:   ..|.:|..:             :..|.:.:.:|...|||:..:|.|.    
Zfish   225 VSSLSGVREYL---SMPMKPTIQRIEMTLTEEHKAYVHGLIEDDLRKYGSLIPVHADDIAEQLQS 286

  Fly  1299 -----FQEMTTIEVTTNLI--------------FKYNLQ---ITTDDIFTFVDGEWLNDAIINFY 1341
                 |.:........:||              |:.|.:   :|.||:.|.....||||.::|.|
Zfish   287 IFNEDFSQTHRKMAVQHLIQSYQRSSGTAMVKGFRVNYKRHVLTMDDLSTLYGQNWLNDQVMNMY 351

  Fly  1342 MSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCM 1406
            ..::.:...::      .:..|:||..:|...||.||:|||:.||:|.||::.:|:|. .|||.:
Zfish   352 GDLVMDSVPEK------VHFFNSFFYDKLRTKGYDGVKRWTKNVDIFQKDLLLIPIHL-EVHWSL 409

  Fly  1407 AIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDC 1471
            ..:.::.::|.|:||....|:.....:.|||..|::.|.|:.| :||:......|:.||.|.|||
Zfish   410 VSVDIKRRSITYFDSQRTLNRRCPKHIFKYLQAEAMIKEKRDF-LTGWKGFFKMNVGRQNNDSDC 473

  Fly  1472 GVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            |.|...:.:.:....|.:|||.:|...|..|..|:...||
Zfish   474 GAFVLQYCKCLALGQPFSFSQQDMPKLRRMMYKELCHCKL 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 58/175 (33%)
senp3bNP_001077311.1 Peptidase_C48 341..513 CDD:280975 59/180 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106174659
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.