DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and senp3a

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001098584.1 Gene:senp3a ZFINID:ZDB-GENE-030131-2303 Length:535 Species:Danio rerio

Alignment Length:297 Identity:80/298 (27%)
Similarity:136/298 (46%) Gaps:42/298 (14%)


  Fly  1227 RRQLESMHL---LGIAEQQANE-------SKDERLAYEKKLREVMFRS-GAPHRPFFEIGPLEQP 1280
            :.||.|.|:   .||.::...:       ..||.:   :||:|:...| .:|||... :..|.| 
Zfish   267 QNQLSSEHISCVQGILDEFLQQYGSLIPIHVDEVV---EKLQEIFTESFSSPHRKIM-VQHLMQ- 326

  Fly  1281 EEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQI-TTDDIFTFVDGEWLNDAIINFYMSM 1344
                             .:|.|:...:.......|...: ..||:.|.....||||.::|.|..:
Zfish   327 -----------------SYQRMSGSAMMRGFRVNYKRHVLVMDDLTTLYGQNWLNDQVMNMYGDL 374

  Fly  1345 LTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII 1409
            :.:.:.::      .:..|:||..:|...||.||:|||:.||:|.|..:.:|:|. .|||.:..:
Zfish   375 VMDAAPEK------VHFFNSFFYDKLRTKGYEGVKRWTKNVDIFQKKFLLIPIHL-EVHWSLVCV 432

  Fly  1410 HLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVF 1474
            ::..:::.|:||....|:.....:.|||..|:: ||:|....||:......|:.||.|.||||.|
Zfish   433 NVPQRSVTYFDSQRTLNRRCPKHIAKYLQAEAI-KREQKDFYTGWKGFFKMNVARQNNDSDCGAF 496

  Fly  1475 SCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            ...:.:.:..:.|.:|.|.:|...|.:|..|:...||
Zfish   497 VLQYCKCLALEQPFSFGQQDMPKLRRQMYKELCHCKL 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 55/175 (31%)
senp3aNP_001098584.1 Peptidase_C48 361..533 CDD:280975 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106174651
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.