DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and senp6a

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_021324231.1 Gene:senp6a ZFINID:ZDB-GENE-080204-25 Length:1036 Species:Danio rerio

Alignment Length:1053 Identity:200/1054 (19%)
Similarity:316/1054 (30%) Gaps:452/1054 (43%)


  Fly   713 VSTPLPPAEAQPGSTSE--DISDPVSP-EHWE------QLESL--------DPSTICIRKTFNLI 760
            :.:|.|.|....|...:  .:|.|:.. ||..      |::|:        ||..:.|::..:..
Zfish   116 IMSPAPQAVVVQGRVFQHAQLSTPIRKLEHRSDLIQRGQMDSIVLTCPEISDPGDLSIKRRVHQK 180

  Fly   761 RDISES------LVADPEQPE------------AEAHRKSIFLLRQKLADVCHKVLTEIIHGRAT 807
            |.|.||      :|..|.||:            :|.|.|         .|.|..:|.        
Zfish   181 RRIGESPVTVSQVVEQPLQPDDYLTVCGECGQPSEDHVK---------CDHCGFILP-------- 228

  Fly   808 DEIISILREILEQTKEIP-------PRPTPK---RDLQEDISMG-------LEIL--KKIR---G 850
                       .:||..|       |||:.:   ..||  ||.|       |:::  ..:|   |
Zfish   229 -----------NETKPRPAIPSALLPRPSIRPQPASLQ--ISKGFYECSQQLDVIVNPSVRITPG 280

  Fly   851 MLSGWYSSRESETDSTDTGTGFQAQNG-KGFGAGRQPENS--------FLSQKRRNQEENPRLI- 905
            .|...::.|.|         |..|.|| |..|..:|..|.        .||....::.:|.... 
Zfish   281 NLLFPHNGRPS---------GSLACNGHKAAGGAKQQLNKPCELNDPIVLSSDEDDESDNVSSTG 336

  Fly   906 KYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPP-----------VYTQHRVRN 959
            ...|:|:..||           |.:|......|...:..::....           .:|.|  ||
Zfish   337 TANRLDSVSPR-----------PADSAHSSPAPSDGRLEAVVKAAGEHEDPSADFFTHTNH--RN 388

  Fly   960 DAP---HVPTPF------DDEESSQRLANAGPS--------------------SRPMTYS-DAVR 994
            ..|   .:..||      |...|.:|..|....                    ::|:.:: |.::
Zfish   389 LLPRRNRMKDPFGNLVSDDATVSKRRKINQEQKLSSIILECRSVRIGTLRRMVTKPVVFTVDFIQ 453

  Fly   995 LGHNG----ISESRVNGHSSHTVRREPSRLHR-SILSHEMNCKDQEQYNELIRTQTNYVGSRYLK 1054
            |...|    :.|| |:..||...|.|...:.: .:|.  :...||    |..|.||.        
Zfish   454 LETEGREVDVLES-VSLKSSELTRCEWCNVKKLPVLF--LQTSDQ----ECQRLQTQ-------- 503

  Fly  1055 PGTPPTFQRAKAQSATSSSCSLQDNQSNITDSF---PSPHGRANPE--LTEYAKLINRQENEENR 1114
                  .|.::........|:..:::..|...|   ||.|.:...|  |||..:           
Zfish   504 ------LQMSQDSGGIWYDCNGNNDEKYIVLIFEHGPSMHEQVILEDILTEIGR----------- 551

  Fly  1115 SPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEAN 1179
                       :|..|...|.||.                       |...|:..|       .|
Zfish   552 -----------NNRLADFPSKISF-----------------------DEANVRLVN-------YN 575

  Fly  1180 EANETKENDAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARANRRQL--ESMHLLGIAEQQ 1242
            :|:..||.       .:::|                  ||...|.::...|  .|:.::.:|...
Zfish   576 KASLEKEK-------VKVEK------------------AEVVAAPSSSALLATPSLSVVTVAVAP 615

  Fly  1243 ANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKE------DHARFQE 1301
            .|.                    ||..|.    |...|  ..:|:|....:|      :.|..|.
Zfish   616 VNT--------------------APAVPV----PCAAP--SVQTRLSARLQEFCDDDDEMAELQP 654

  Fly  1302 MTTIEVTTNLIF-----KYNLQITTDDIFTFVDGEWLNDAIINFYMSML-TERSEKRAGELPATY 1360
            ..|..:...|::     |..:.:|.:|:....|||:|||.||:||:..| .|:.:|.  :...::
Zfish   655 TFTGPIIKLLVYPPPPAKGGISVTNEDLHCLSDGEFLNDVIIDFYLKYLFLEKLKKE--DAARSH 717

  Fly  1361 AMNTFFMPRLLQ----------------AGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII 1409
            ..::||..||.|                ..:..|:.|||.||||.||.|.||:: .:.||.:|:|
Zfish   718 VFSSFFYKRLNQRERRNTVDTSSLPIQKRKHNRVKTWTRHVDLFQKDFIFVPIN-ESAHWYLAVI 781

  Fly  1410 ------------------------------------HLRNKT----------------------- 1415
                                                .|...|                       
Zfish   782 CFPGLESAQVEPNPLYQPQTAVSSSPPTDGASEQRDQLSQNTAGPHRADANQVQFTDGLRRIIEY 846

  Fly  1416 ------------------------------------------------IFYYDSMGRPNQ-PALD 1431
                                                            |...||:..|.: ..:.
Zfish   847 STEDDSHQSDDQSSCQDECSEDGALADDSGSFDRAEWTSKPTICKQPCILIMDSLRGPTRSTVVK 911

  Fly  1432 ALVKYLHEESLDKR--KQPFD---MTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFS 1491
            .|.:||..|...|:  |:.|.   |.|    ::..:|:|.|.|||||:...:.|        :|.
Zfish   912 TLREYLEVEWEVKKGSKRSFGKELMKG----SSPRVPQQDNFSDCGVYVLQYVE--------SFF 964

  Fly  1492 QAEMLYFRTKMAL 1504
            ::.:..|...|.|
Zfish   965 ESPLPSFHLPMNL 977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 61/305 (20%)
senp6aXP_021324231.1 ULP1 <551..1002 CDD:227489 98/546 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.