DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp18

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001002834.1 Gene:Senp18 RGDID:1303230 Length:475 Species:Rattus norvegicus

Alignment Length:646 Identity:167/647 (26%)
Similarity:244/647 (38%) Gaps:194/647 (30%)


  Fly   881 GAGRQPENSFLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLS 945
            |.|.:||.|...:||::.::|.                |...:|.|.|..|...:|..|     .
  Rat     8 GVGMKPEASEQRRKRKHLDQNG----------------TETESEALGPEPSRNCQDGAQ-----M 51

  Fly   946 IFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSS 1010
            :|..|                                                  .::|...|..
  Rat    52 VFQKP--------------------------------------------------GKARKKTHQE 66

  Fly  1011 HTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKP--GTPPTFQRAKAQSATSSS 1073
            |..::         |:.|...|.|.|     :||..  ||..:||  |.|.  |....:|.....
  Rat    67 HQDQK---------LNKEQPGKGQGQ-----KTQDE--GSGNIKPLEGLPD--QAVVEKSTEGGK 113

  Fly  1074 CSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHASTISS 1138
            |                  |..|    |:.|     .|:.:||..::..|:..:....|.     
  Rat   114 C------------------RKRP----YSVL-----QEKPQSPQNEKHARSLEHLQGGHP----- 146

  Fly  1139 SASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEAN------EANETKENDAPQPTTTRI 1197
                                 |:..|.......::.:|...      ...||...|. ||:|..:
  Rat   147 ---------------------VRSDPHRPHPTFSDTSNNKGGMPGHPHGRETAHGDR-QPSTEVL 189

  Fly  1198 KKPDFLHRRFANCIFLRNDFAENFKARANRRQLESMH-LLGIAEQQANESKDERLAYEKKLREVM 1261
            ..     :|...|       ||....|.|  .||  | |.|.|.....:|...||..:|......
  Rat   190 ST-----KREKRC-------AEEKCVRGN--SLE--HGLPGTANANILDSGGGRLLPDKVAVVAG 238

  Fly  1262 FRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDIFT 1326
            .::..|.:        |..:||:.||  .:.||...........|:   |...:.|:||..|:.|
  Rat   239 EKNALPEQ--------ENNQEKEFTK--EMEKEVEKALGPGAQEEI---LSTGFKLKITRGDMQT 290

  Fly  1327 FVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKD 1391
            ..:|:||||.:|||||::|.:|:|...  .||.:|.:|||..:|...||..|:||||.::||.|:
  Rat   291 LKNGQWLNDEVINFYMNLLVQRNENPG--YPALHAFSTFFYAKLKHGGYNSVKRWTRGINLFEKE 353

  Fly  1392 IIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVV 1456
            :|.||:| ..|||.:.:|.||.::|.|.||||:..:...:.:..||..||..:|....|    .|
  Rat   354 LILVPIH-QRVHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQNESKTRRNMELD----PV 413

  Fly  1457 E------NAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            |      .:|.||:|.|.||||:|:|.:|:||:||.|:||||..|..||.:|..||....|
  Rat   414 EWKQYSLTSQEIPQQLNGSDCGMFTCKYADYISRDQPVTFSQQHMPLFRKRMVWEILHSHL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 79/181 (44%)
Senp18NP_001002834.1 Peptidase_C48 <244..470 CDD:304959 96/246 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T131225
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.970

Return to query results.
Submit another query.