DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp17

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001002833.1 Gene:Senp17 RGDID:1303080 Length:475 Species:Rattus norvegicus

Alignment Length:499 Identity:135/500 (27%)
Similarity:200/500 (40%) Gaps:136/500 (27%)


  Fly  1053 LKPGTPPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQEN---EENR 1114
            ||...|...|..|.|         ::...||......|......:|.|..|...||.:   |:.:
  Rat    72 LKKEQPGKGQGQKTQ---------EEGSGNIKPLECQPDQTVVEKLAEGGKCRKRQYSVLQEKPQ 127

  Fly  1115 SPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEAN 1179
            ||..::..|:..:....|.                          |:..|.......::.:|...
  Rat   128 SPQNEKHARSLEHLQGGHP--------------------------VRSDPHRPHPTFSDTSNNKG 166

  Fly  1180 ------EANETKENDAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARANR-----RQLESM 1233
                  ...||...|. ||:|..:..     :|...|       ||....|.|.     |..|:.
  Rat   167 GMPGHPHGRETAHGDR-QPSTEVLST-----KREKRC-------AEEKCVRGNSLEHGLRGTENA 218

  Fly  1234 HLL--------------------GIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLE 1278
            ::|                    .:.||:.|:.|:.....||::.:.             :||..
  Rat   219 NILDSGGGRLLPDKVAVVAGEKNALPEQENNQEKEFTKEMEKEVEKA-------------LGPGA 270

  Fly  1279 QPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMS 1343
            |.|                            .|...:.|:||..|:.|..:|:|.||.||||||:
  Rat   271 QEE----------------------------ILSTGFKLKITRGDMQTLKNGQWPNDEIINFYMN 307

  Fly  1344 MLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAI 1408
            :|.:|:|.:.  .||.:|.:|||..:|...||..|:||||.::||.|::|.||:| ..|||.:.:
  Rat   308 LLVQRNENQG--YPALHAFSTFFYAKLKHGGYNSVKRWTRGINLFEKELILVPIH-QRVHWSLVV 369

  Fly  1409 IHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVE------NAQNIPRQGN 1467
            |.||.::|.|.||||:..:...:.:..||..||..:|....|    .||      .:|.||:|.|
  Rat   370 IDLRKRSIVYLDSMGQTGKNICETIFHYLQNESKTRRNMELD----PVEWKQYSLTSQEIPQQLN 430

  Fly  1468 SSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            .||||:|:|.:|:||:||.|:||||..|..||.:|..||....|
  Rat   431 GSDCGMFTCKYADYISRDQPVTFSQQHMPLFRRRMVWEILHSHL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 79/181 (44%)
Senp17NP_001002833.1 Peptidase_C48 <244..470 CDD:304959 97/274 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.