DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Gm9839

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001186885.1 Gene:Gm9839 MGIID:3641910 Length:478 Species:Mus musculus

Alignment Length:515 Identity:144/516 (28%)
Similarity:225/516 (44%) Gaps:98/516 (19%)


  Fly  1054 KPGTPPTFQRAKAQSAT----SSSCSLQDNQSNITDS----FPSPHGRAN-------PELTEYAK 1103
            ||......|:.|.|..:    .|....||.:....|.    |..| |:|.       |:|....:
Mouse     4 KPEASGKGQKRKHQDESRIEIDSEALGQDTKRKCQDGTKMVFKVP-GKAQKMTPQEPPDLELPIE 67

  Fly  1104 LINRQENEENRSPAPQQPK---------------RNASNSSASHASTISSSASSSCSTCSTCSSS 1153
            ..::.:..:.:...|.|||               |..::|...|....|             :..
Mouse    68 QSSKGQVRKPQGETPNQPKPLELTEGPPEQVVTGRVPADSGKGHKRPYS-------------AME 119

  Fly  1154 DTEPMLVKDSPE----------VKEANEANEANEANEANETKENDAPQPTTTRIKK----PDFLH 1204
            :.|.:..|:...          :|........:|.:..:||...| |:|:|....|    ||...
Mouse   120 ENEQIPQKEKKRRLLQNLKLILIKAGKIKGGESEDSHGSETTLRD-PEPSTVVALKECLSPDERE 183

  Fly  1205 RRFANCIFLRNDFAENFKA------RANRRQLESMHLLGIAEQQANE---SKDERLAYEKKLREV 1260
            :    |.|......|....      |.|..:..:...:.:...:.|.   :|...||.:||    
Mouse   184 K----CCFEETSVTEKKGCVKVEGRRGNSLEPGTQAQIILDSSRGNSLLPNKMAVLAAQKK---- 240

  Fly  1261 MFRSGAPHRPFFEIGPLEQPEEKK-ETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDI 1324
            ..|....||...:|..:.:..||: |..|.|..:|           |:.::   ::.||||..||
Mouse   241 PLRDHEKHREMDQILDITEDMEKEIENALGPGPQE-----------EILSS---RFKLQITRGDI 291

  Fly  1325 FTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFS 1389
            .|..:.:||||.:|||||::|.||:|.:.  .||.:..:|||.|:|..:||:.|:||||.::||.
Mouse   292 QTLKNSQWLNDEVINFYMNLLVERNENQG--YPALHVFSTFFYPKLKHSGYSSVKRWTRGINLFE 354

  Fly  1390 KDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRK---QPFDM 1451
            |::|.||:| ..:||.:.:|.||.::|.|:||||:..:...:.:.:||..||..:|.   .|.:.
Mouse   355 KELILVPIH-QRLHWSLVVIDLRKQSIAYFDSMGQTGKSICETIFQYLQNESKTRRNIELDPLEW 418

  Fly  1452 TGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            ..:.| ..:.||.|.|.||||:|:|.:|:||.||.|:||||..|..||.:|..||...:|
Mouse   419 KQYSV-TIEEIPLQMNGSDCGMFTCKYADYIARDQPVTFSQQHMPTFRKRMVWEILHSQL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 77/178 (43%)
Gm9839NP_001186885.1 Peptidase_C48 <231..473 CDD:304959 101/264 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.880

Return to query results.
Submit another query.