DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Gm5415

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001157758.1 Gene:Gm5415 MGIID:3644687 Length:478 Species:Mus musculus

Alignment Length:491 Identity:134/492 (27%)
Similarity:219/492 (45%) Gaps:89/492 (18%)


  Fly  1063 RAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPK----- 1122
            :.|.|..|:....:......:|...|       |:|....:..::.:..:::...|.|||     
Mouse    34 KRKCQDGTTMVFKVPGKAQKMTPQEP-------PDLELAIEQFSKGQVRKSQGETPNQPKPLELT 91

  Fly  1123 ----------RNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPE----------VK 1167
                      |..::|...|....|             :..:.|.:..|:...          :|
Mouse    92 EGPPEQVVTGRAPADSGKGHKRPYS-------------AMEENEQIPQKEKKRRLLQNLKLILIK 143

  Fly  1168 EANEANEANEANEANETKENDAPQPTTTRIKK----PDFLHRRFANCIFLRNDFAENFKA----- 1223
            ........:|.:..:||...| |:|:|....|    ||...:    |.|......|....     
Mouse   144 AGKIKGGESEDSHGSETTLRD-PEPSTVVALKECLSPDEREK----CCFEETSVTEKKGCVKVEG 203

  Fly  1224 -RANRRQLESMHLLGIAEQQANE---SKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKK 1284
             |.|..:..:...:.:...:.|.   :|...||.:||    ..|....||...:|..:.:..||:
Mouse   204 RRGNSLEPGTQAQIILDSSRGNSLLPNKMAVLAAQKK----PLRDHEKHREMDQILDITEDMEKE 264

  Fly  1285 -ETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTER 1348
             |..|.|..:|           |:.::   ::.|.||..||.|..:|:||||.:|||||::|.||
Mouse   265 IENALGPGPQE-----------EILSS---RFKLLITRGDIQTLKNGQWLNDEVINFYMNLLVER 315

  Fly  1349 SEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRN 1413
            :|.:.  .||.:..:|||.|:|..:||:.|:||||.::||.|::|.||:| ..:||.:.:|.||.
Mouse   316 NENQG--YPALHVFSTFFYPKLKHSGYSSVKRWTRGINLFEKELILVPIH-QRLHWSLVVIDLRK 377

  Fly  1414 KTIFYYDSMGRPNQPALDALVKYLHEESLDKRK---QPFDMTGFVVENAQNIPRQGNSSDCGVFS 1475
            ::|.|:||:|:..:...:.:.:||..||..:|.   .|.:...:.:. ::.||.|.|.||||:|:
Mouse   378 QSIAYFDSIGQTGKSICETIFQYLQNESKTRRNIELDPLEWKQYSMA-SEEIPLQMNGSDCGMFT 441

  Fly  1476 CMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            |.:|:||.||.|:||||..|..||.:|..||...:|
Mouse   442 CKYADYIARDQPVTFSQQHMPTFRKRMVWEILHSQL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 75/178 (42%)
Gm5415NP_001157758.1 Peptidase_C48 <231..473 CDD:304959 99/264 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130979
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.