DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and velo

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_648056.1 Gene:velo FlyBaseID:FBgn0035713 Length:1833 Species:Drosophila melanogaster

Alignment Length:1617 Identity:300/1618 (19%)
Similarity:509/1618 (31%) Gaps:544/1618 (34%)


  Fly   179 PLPEP--PSLPTITLTVDAL--IDLDQNNQVAYYVQQ----YNNQPVLYQQ-------NIHIGTG 228
            ||.||  ..|..:.:..|.:  :.|..:.|:.:..||    ....|..|||       ..||..|
  Fly     7 PLEEPVYSDLQVVQVPQDEVGSLVLQDDQQLVFNDQQQVVYQTTAPAQYQQPQQSAAPTYHIIGG 71

  Fly   229 IQLCDQASENNQPIILHIVEHNPQTITESQEQFHQVVPEIQINNIQEQDQKFENGISEQNHPIAT 293
            ..|..|..           :|..|...:.|:|..|..|:     .|.|.|:.:..:..|.|    
  Fly    72 DDLAHQQQ-----------QHQQQQQQQQQQQQQQQQPQ-----QQHQQQQQQVVMHHQQH---- 116

  Fly   294 EAQDQTLTEIRDENQIVLAVQEKNLTRASEIQDQNQQTLTEIPEK-CLQIASPV-TTDIQVQSPQ 356
              |.|.:.::..:.|.....|::......:.|.|.||.:...|:: .:|....: .|..||..|.
  Fly   117 --QVQQVQQVHYQQQQQEPQQQQQQLHMEQQQQQQQQYVQHQPQQPAIQHTQQIYYTSEQVLQPN 179

  Fly   357 VVIE-IQEQNHQSVTEIQEEVHQTAPEIQVNVFQTSSDIQGQNHQIVTEEQNHQTITETQEDYSA 420
            .::: :|:|..|.....|::..|...:.....:|..|..|||...:.:.:|.||...:.|.....
  Fly   180 AIVQHMQQQKKQQQVLQQQQQQQQQYQQHAPAYQVQSSPQGQAQLLQSSQQQHQQAQQAQTLQLQ 244

  Fly   421 VSEIQWENLSFSAEIQEQNQQIVTEVTKLASPSVTDIQAQSPQSVIEIQDDDDEDLKFESDDLHT 485
            .|..|.:        .:|:||||..:|       |..|.|.|..::              ::.|.
  Fly   245 TSPPQQQ--------PQQHQQIVYRMT-------TTQQQQRPLGML--------------NNTHV 280

  Fly   486 IPEIQEKNQQSPQ---FVIE--IHYDNEDLKFASDNQEQDQQTAELQKERFQFASEIEKRDLQIV 545
            |.:.|....|.||   .::.  ||..|..:.:|:..|:|.||                    |.|
  Fly   281 IVQQQPVLIQGPQHQELIMRQAIHPYNNRVVYATSPQQQQQQ--------------------QHV 325

  Fly   546 TDTHKQNYHNVTDIPFATYIQEENEQLTPEDQEEDQHYLNFEGNQQFQLQKQDQLS-------VP 603
            ...|.|                         |::.|.:...:..||.|||...|.:       ||
  Fly   326 IQQHVQ-------------------------QQQVQQHQQVQQQQQMQLQPTTQTAHLVQARVVP 365

  Fly   604 QIQKQTHQFESKVKKRKLQPFSEYQQKGQKDHIQERQYI-QQEFTIHSNQAYSKVQYIQ------ 661
            | |.|...:: :::.:|:||    ||:.|....|:.|.: ||:..:.:..|....|.::      
  Fly   366 Q-QTQNVVYQ-QLQVQKVQP----QQQQQAPQQQQPQLVAQQQPQLVATSAAGGTQLVRASFRKS 424

  Fly   662 -----------TIQTATPYVPQLEISQENSFEVQPAYEVNEGQRDREL---------------VS 700
                       |:.|..|.:....|.:    :|:|......|...|.:               .|
  Fly   425 PRGGAVLARPGTLITTRPTLTPTTIVR----QVRPRGGAVPGGLVRNMRPAGVRPTRAQLVVQTS 485

  Fly   701 YTGHEHQNFVDE-------VSTPLPPAEAQPGSTSEDISDPVSPEHWEQLESLDPSTICIRKTFN 758
            .:|......|.:       :||.|...:.|.....:.     .|.|             |.:| :
  Fly   486 ASGEGQTMLVTQGQMKHITISTNLGQPQQQQQQQMQQ-----QPRH-------------IYRT-H 531

  Fly   759 LIRDISESLVADPEQPEAEAHRKSIFLLRQKLADVCHKVLTEIIHG--RATDEIISILREILEQT 821
            ::.|      .:|:|.:.:|.::.    .|:     |:.:..:.||  |....:.|.:...::  
  Fly   532 MVTD------GNPQQQQQQAAQQQ----PQQ-----HQQMLMMRHGPVRYRAPVSSAVAAPVQ-- 579

  Fly   822 KEIPPRPTPKRDLQEDISMGLEILKKIRGMLSGWYSSRESET---------DSTDTGTGFQAQNG 877
               .|.||......:..::|:::.::|...:......:...|         .....|||......
  Fly   580 ---APAPTAAGGGVQTSNIGMDLEERIEAAVLKKEQQKPQPTAQPVASNQLQPMQIGTGTTLTTY 641

  Fly   878 KGFGAGRQPENSFLSQKRRNQEENPR--------------------LIKYRR----------VDN 912
            ...|...|.|.....|:::.|::..:                    |.:|::          |..
  Fly   642 YPAGTASQEEEQQQQQQQQQQQQQQQQQVVQSQQQGIRPPSGASMTLAEYKKRQTLSASPAPVPP 706

  Fly   913 SFP------------------RLITNETAEDLIPNNSMAKRDQP------------------QSS 941
            |.|                  ::...:.|..|.|...:.:..:|                  .|.
  Fly   707 SNPGLAPMRATPPGTMVRPTAKITPTQHAGALPPGTRIMQPQRPVPAAVAAPIPAPAAVTQGSSV 771

  Fly   942 KRLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYS--------------DA 992
            .:.|..|..:::||.:.|.|.......|...:...:..|....|.:|::              ..
  Fly   772 MKTSHNNYEIHSQHVLNNRAGQEIAERDKNSAKMLVILASGEQRLITFTLPRESCTVQDLLEQVG 836

  Fly   993 VRLGHN-GISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPG 1056
            |...|| .|......|.:...|......:|.|........::..|.|.....|....|:......
  Fly   837 VPFDHNTTIQCVEHRGANVDFVVTVGFTVHESASELISRAEESLQMNRSQENQAAVAGAAAAANS 901

  Fly  1057 TPPT-------------FQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLI--- 1105
            .|.|             .::||.::|:|:|       .|......|..|.|....:|..|||   
  Fly   902 NPATTSASPAYAQANAAAEQAKREAASSAS-------GNTVVGTVSSAGSAGATPSEGRKLIDGF 959

  Fly  1106 ------------NRQENEENRSPAPQQPKRNA---SNSSASHASTISSSASSSCSTCSTCSSS-- 1153
                        :....|..:...|:.|||.:   .||:||  |..|||:|...|...|.:..  
  Fly   960 LAVCQLCGFTGVDHARCERCKRVFPEPPKRKSYVPKNSAAS--SPASSSSSEPVSAVPTAADKKR 1022

  Fly  1154 ------------------------------------------DTEPMLVKDSPEVKEANEANEAN 1176
                                                      :.:|:::..|.:..|..|....:
  Fly  1023 ELAAARFNNKMAGANFAVGVGVRGRGSMAMRGGRARGGRRVPEVDPVVLLSSEDEAEGGEGTSDS 1087

  Fly  1177 EANEANETKEN--------DAPQPTTTRIKKPDF--LHRRFANCIFLRNDF--------AENFKA 1223
            .....|.:|.|        .|..|....:.:.|.  |::.|:     |.|.        |:.|.|
  Fly  1088 SNQPTNNSKLNSNGNLHELSAAFPCEPNLPEIDEEPLYKDFS-----RGDVRDLSDIPEADQFSA 1147

  Fly  1224 RAN---------RRQL--------ESMHLLGIAEQQANESKDERLAYEKKLREVM-----FRSGA 1266
            ...         |.::        :.:.:.||.     :.|||:.......:||:     |.:..
  Fly  1148 SLKCSCVRLVPYRFEITEPVCFTTKGVRIAGIL-----KDKDEKFELNIHKQEVIKVIAHFGNVE 1207

  Fly  1267 PHRPFFEIGPLEQPEE--KKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYN------------- 1316
            |.:|...:..|:...|  |.:.||......:|..|:  |....|..||..::             
  Fly  1208 PAQPLVTLYLLKTCAEYVKNQLKLPDDQHHEHTGFK--THSYHTRRLILLFDSISVSARGNIKSM 1270

  Fly  1317 --------------------------------------------------------LQITTDDIF 1325
                                                                    |.|..:|..
  Fly  1271 FSCVDEISSTDAAEILERIADSDRKTQDKSSQPPPRQLRADEQVSLLMYPPKGTGGLCIRMEDFV 1335

  Fly  1326 TFVDGEWLNDAIINFYM-----SMLTERSEKRAGELPATYAMNTFFMPRL-------------LQ 1372
            ......:|||.||:||:     :::.|...:|      |:..:|||..||             .|
  Fly  1336 CLTKESYLNDIIIDFYLLWLRNTLIPEPQRER------THIFSTFFYKRLTTLTRPADMKQTAAQ 1394

  Fly  1373 AGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRN-KTIFYYDSMGRPNQP 1428
            ..:|.|::||:.||:|.||.|.||:: ...||.:|||...| |....:|:    |||
  Fly  1395 KRHARVQKWTKGVDIFDKDFIIVPIN-EQSHWFLAIICYPNLKGPVTFDT----NQP 1446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064 82/399 (21%)
Peptidase_C48 1331..1506 CDD:280975 39/118 (33%)
veloNP_648056.1 Peptidase_C48 1342..>1434 CDD:304959 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.