DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and CG11023

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_787955.2 Gene:CG11023 FlyBaseID:FBgn0031208 Length:480 Species:Drosophila melanogaster

Alignment Length:596 Identity:313/597 (52%)
Similarity:384/597 (64%) Gaps:132/597 (22%)


  Fly   932 MAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTPF----DDEESSQRLANAGPSSRPMTYSDA 992
            |.:|||||||:|:|||||||||||:|||:||::||.|    ||||||||:||||||.||:|||||
  Fly     1 MGERDQPQSSERISIFNPPVYTQHQVRNEAPYIPTTFDLLSDDEESSQRVANAGPSFRPLTYSDA 65

  Fly   993 VRLGHNGISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRT--QTNYVGSRYLKP 1055
            |||..||.:.|||:||||:||||.|:.:.|||||.||...|||||..||||  |:|.|||.|.:|
  Fly    66 VRLSQNGFANSRVSGHSSYTVRRPPALVDRSILSQEMERMDQEQYIYLIRTAAQSNSVGSHYAEP 130

  Fly  1056 GTPPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQ 1120
                                                                             
  Fly   131 ----------------------------------------------------------------- 130

  Fly  1121 PKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETK 1185
                                                   |.|:.|||:.:|.|            
  Fly   131 ---------------------------------------VTDNSEVKKVSETN------------ 144

  Fly  1186 ENDAPQPTT---TRIKKPDFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQ----- 1242
            ::|||||.|   ||:.:.:.||||||:|:.|.:||||.|||||...:.:|.|.|.:||:|     
  Fly   145 KSDAPQPLTPQPTRLTRTESLHRRFASCVNLNDDFAEQFKARAADCEEKSKHRLRLAEEQRLFSN 209

  Fly  1243 --ANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTI 1305
              |.::.||..|||:|:.|.:|:|...|:|.|.:|||::|..||.|||||||:|.|.||.|:|..
  Fly   210 FSAIKNIDELRAYERKVVENIFQSCIAHKPIFVLGPLDKPNVKKVTKLIPLTEEHHDRFNEITQD 274

  Fly  1306 EVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRL 1370
            :.:|.:|||:||.|||:||.||::|:||||.:||||||:||||||||:|.||||||:||||:|||
  Fly   275 DKSTEIIFKFNLHITTEDICTFINGKWLNDEVINFYMSLLTERSEKRSGVLPATYAINTFFVPRL 339

  Fly  1371 LQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVK 1435
            ||||:||::||||||||||||||||||||..|||||||||||||||.||||.|:||:|.||||.|
  Fly   340 LQAGHAGIKRWTRKVDLFSKDIIPVPVHCNGVHWCMAIIHLRNKTIRYYDSKGKPNRPVLDALEK 404

  Fly  1436 YLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRT 1500
            ||.|||:.|.|:.||.:.||:|:.||||||.:.||||:||||||||||.||||||:|:||||||.
  Fly   405 YLREESIFKPKKQFDTSDFVIESVQNIPRQLDGSDCGIFSCMFAEYITCDVPITFTQSEMLYFRK 469

  Fly  1501 KMALEIADGKL 1511
            ||||||.||:|
  Fly   470 KMALEIVDGEL 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 136/175 (78%)
CG11023NP_787955.2 Peptidase_C48 300..475 CDD:280975 136/175 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090140
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12606
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.