DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and CG12717

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster

Alignment Length:667 Identity:139/668 (21%)
Similarity:238/668 (36%) Gaps:178/668 (27%)


  Fly   911 DNSFPRLITNE---TAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYT---QHRVRNDAPHVPTPFD 969
            |.:..|:..|:   .:..|:.|.  |..|..:.|.|:.|    :|:   ||.|....|::.....
  Fly    10 DQAVRRIAHNDFILVSRQLLINR--ADTDPDKGSARMLI----IYSSGKQHIVTFKLPNLACRVQ 68

  Fly   970 D---------EESS--QRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREPSRLHRS 1023
            |         :||:  ..:.|||.... :..|....:..| |:|:  ..|:....|    ::|:|
  Fly    69 DLFFQMDLQIDESTTIDCIENAGGIIH-LVVSVGFPISDN-IAET--VAHAEEFYR----KVHQS 125

  Fly  1024 ILSH----EMNCKDQEQYNELIRTQTNYVGSRYLKP--------GTPPTFQRAKAQSATSSSCSL 1076
            ..|.    ..|....|:::..:           :||        |..|.....|.:....|.|..
  Fly   126 KASSADAAPPNAMAGEEHSPAV-----------VKPSETAVANNGCQPAASATKGKKHKKSPCGS 179

  Fly  1077 --QDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSS 1139
              ::|...:..| .......|.:..:..|....::|...::.:......::.|...||.||    
  Fly   180 PGENNDGQVILS-ADQDANTNTKAKKQKKCHIAKDNNGIQAASSHDNPSSSGNKQGSHNST---- 239

  Fly  1140 ASSSCSTCSTCSSSDTEPMLVKDSPEVKE-ANEANEANEANEANETK--ENDAPQPTTTRIKKPD 1201
            |.:|.||.::......:|  .:|:|.:.: ....|.|..:.::.||.  .....|.....|..|.
  Fly   240 AITSNSTMTSNGLRGVQP--AEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSNVASISSPA 302

  Fly  1202 FLHRRFANCIFLRNDFAENFKARANRRQL-------ESMHLLGIAEQQANESKDERLAYEKKLRE 1259
            ......| .|....:.||..:.|.||..:       :::.|:...:::...:.|.:.  |::|  
  Fly   303 VKATSDA-AIPTPAERAERSRLRRNRNWILSRDVDEDAVVLVSSGDEETTAADDGQT--ERRL-- 362

  Fly  1260 VMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDI 1324
                               .|:|.:.....|.|...                    .|.||..|.
  Fly   363 -------------------SPDENQTLFTYPPTGTG--------------------GLSITIKDF 388

  Fly  1325 FTFVDGEWLNDAIINFYMSMLTER---SEKRAGELPATYAMNTFFMPRL-------------LQA 1373
            .....|.:|||.||:||:..|...   .|:|    ..|:..:|||..||             .|.
  Fly   389 MCLSKGSYLNDIIIDFYLRWLKNNIIPEEQR----DRTHIFSTFFHKRLTTRTNPRNTKQTAAQK 449

  Fly  1374 GYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII---HLRNKT-------------------- 1415
            .:..|.:|||.|::|.||.|.:|.: ...||.:|||   :||:..                    
  Fly   450 RHERVEKWTRNVNIFDKDFIIIPFN-EQSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPL 513

  Fly  1416 IFYYDSMGRPNQPALDALVK-YLHEESLDKRKQP---------FDMTGFVVENAQNIPRQGNSSD 1470
            |..:||:...::....|::: ||..|  .|.|.|         .:|.|..||    :|:|.|.:|
  Fly   514 ILIFDSLAVTSRHRAIAILRDYLTCE--HKAKYPNALAHVFNKDNMPGHSVE----VPQQQNLTD 572

  Fly  1471 CGVFSCMFAE-YITRDV 1486
            ||::...:.| :.|:.:
  Fly   573 CGLYLLQYVEQFFTKPI 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 56/207 (27%)
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 39/216 (18%)
Peptidase_C48 396..585 CDD:304959 55/200 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.