DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp5

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_008767029.1 Gene:Senp5 RGDID:1304604 Length:811 Species:Rattus norvegicus

Alignment Length:853 Identity:173/854 (20%)
Similarity:294/854 (34%) Gaps:243/854 (28%)


  Fly   748 PSTICIRKTFNLIRDISESLVADPEQPEAEAHRKSIFLLRQKLADV--CHKVLTEIIHGRATDEI 810
            |..:|..|.     .:...:|...:....:.:::.:.:.:....||  |.|..:    |.||..:
  Rat    34 PQNLCFLKA-----KLGRPVVWHRQSKHFQCNKRGLHIQKTWTQDVPLCSKTKS----GVATQNV 89

  Fly   811 ISILREI-LEQTKEIPPRPTPKRDLQED------ISMGLE------ILKKIRGM----LSGWYSS 858
            .|:..:: .:.||...........||.|      .::|.|      :||.:.|:    :.|..:.
  Rat    90 SSLYAKVKRKDTKHFISSSRSLLKLQADKLLSSAKNLGREYCREKSLLKAVTGLSANTVLGKANG 154

  Fly   859 RESETD--STDTGTGFQAQNGKGFGAGR---------------------------------QPEN 888
            .:..||  ::|....|..::.....:|:                                 ||..
  Rat   155 HKPSTDPQASDFPMKFNGESQSPSDSGKTVVLNKHRKRVCYGCYQGLEHHRNRRPLIPKKFQPNQ 219

  Fly   889 S----------------------FLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNN- 930
            .                      |.||..|.:.   |:.|.|:...|:.:.:|.:..|:...|| 
  Rat   220 HRRVKVSLMMYEKLSMIRFRYRIFRSQHFRTKS---RVCKLRKAQRSWVQKVTGDHQENFRDNNT 281

  Fly   931 -----SMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVP------TPFDDEESSQRLANAGPSS 984
                 |.....:|:...|...:.|.:.:...|:....|||      :|..|:|..  |..|.|..
  Rat   282 EGGDCSPVPSLEPKDPCRCQPYFPDMDSSAVVKGKNCHVPDGHTKESPALDKEHG--LDAAFPDQ 344

  Fly   985 RPMTYSDAVRLGHNGISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVG 1049
            :                    ||.:::|..:..|       |.:..|  .||.:|:  ....:..
  Rat   345 Q--------------------NGSTTYTWDQPSS-------SPKWEC--TEQIHEI--PLMGHPS 378

  Fly  1050 SRYLKPGTPPTFQRAKAQSATS--SSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEE 1112
            |....|||.........:|.||  |...::.:.|...:|..|..|                    
  Rat   379 SDNFTPGTERALMTLGQESGTSAVSDDGVKLSVSGADESVSSVDG-------------------- 423

  Fly  1113 NRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANE 1177
               |..::|.:|.:.......|...:..||.......|.|    |:   |:|.|     .:|...
  Rat   424 ---PVSEEPAQNENFQMEEDGSLRQNILSSKLLDHPYCKS----PL---DAPLV-----CSELKV 473

  Fly  1178 ANEANETKENDAPQPTTTRIKKPDFLHRRFANCI--FLRNDFAENFKARANRRQLESMHLLGIAE 1240
            .|:....|......|..         ..:.:.|:  ||    .|..|...:...|....:||   
  Rat   474 ENQVAGGKSGQTASPVD---------DEQLSTCLSGFL----DEVMKKYGSLVPLSEKDVLG--- 522

  Fly  1241 QQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTI 1305
                           :|::|.....:..:||.         .::.|..       .||.|:    
  Rat   523 ---------------RLKDVFNEDFSNRKPFI---------NREITNY-------RARHQK---- 552

  Fly  1306 EVTTNLIFKYNLQITTDDIFTFVDGE-WLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPR 1369
               .|....||..:...|....:||: ||||.:||.|..::.:....:      .:..|:||..:
  Rat   553 ---CNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDK------VHFFNSFFHRQ 608

  Fly  1370 LLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALV 1434
            |:..||.||:|||:|||||.|.::.:|:|. .|||.:..:.|.::.|.:|||.|...:..::.:.
  Rat   609 LVTKGYNGVKRWTKKVDLFKKSLLLIPIHL-EVHWSLITVTLSSRIISFYDSQGIHFKFCVENIR 672

  Fly  1435 KYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFR 1499
            |||..|:.:|.:..| :.|:.....:.||:|.|.||||||        ...|..||...|::...
  Rat   673 KYLLTEAREKNRPEF-LQGWQTAVTKCIPQQKNDSDCGVF--------VLQVNTTFRVCELVGLF 728

  Fly  1500 TKMALEIA 1507
            .:|.:..|
  Rat   729 REMIVACA 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 57/176 (32%)
Senp5XP_008767029.1 Peptidase_C48 576..714 CDD:304959 52/154 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.