DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp3

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001013134.2 Gene:Senp3 RGDID:1312040 Length:568 Species:Rattus norvegicus

Alignment Length:676 Identity:135/677 (20%)
Similarity:233/677 (34%) Gaps:183/677 (27%)


  Fly   868 TGTGFQAQNGKGFGAGRQ----PENSFLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIP 928
            :|.||....|.|.....:    |..||.:.....:||                    |..||   
  Rat    42 SGGGFGPDPGSGTTVPTRRLPGPRPSFDASASEEEEE--------------------EEEED--- 83

  Fly   929 NNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAV 993
                   ::..::.||    ||.:.|... :..|....|...:..|||...|..:.:.:.||.:.
  Rat    84 -------EEEVAAWRL----PPRWGQLGT-SQRPRALRPSHRKTCSQRRRRAMRAFQMLLYSKST 136

  Fly   994 RLGHNGISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTP 1058
            .|..:.....|..|             .|..|:|..|                     :|.|   
  Rat   137 SLTFHWKLWGRHRG-------------RRRNLAHPKN---------------------HLSP--- 164

  Fly  1059 PTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKR 1123
               |...|.....|.|.          .|.||.|...|.|.....|: .::......|.|..|..
  Rat   165 ---QEGGATPQVPSPCC----------RFDSPRGLPPPRLGLLGALM-AEDGMRGSPPVPSGPPM 215

  Fly  1124 NASNSSASHASTIS-SSASSSCS-------------------------TCSTCSSSDTEPMLVKD 1162
            .......:..|.:. .|...||:                         ..:.||..|      ..
  Rat   216 EEDGLRWTPKSPLDPDSGLLSCTLPNGFGGLSGPEGERSLAPPDASILISNVCSIGD------HV 274

  Fly  1163 SPEVKEANEANEANEANEANETKENDAPQPTTTRIKKPDFLHRRFANCI-FLRNDFAENFKARAN 1226
            :.|:.::::...|.||:...|.....:|            |......|: .:.::|.:.:.:   
  Rat   275 AQELFQSSDLGTAEEADRPGEKAGQHSP------------LREEHVTCVQSILDEFLQTYGS--- 324

  Fly  1227 RRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPL 1291
                    |:.::..:..|          ||.::..:              |.....:::.::.|
  Rat   325 --------LIPLSTDEVVE----------KLEDIFQQ--------------EFSTPSRKSLVLQL 357

  Fly  1292 TKEDHARFQEMTTIEVTTNLIFKYNLQI-TTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGE 1355
            .:.    :|.|....:.......|...: |.||:.|.....||||.::|.|..::.:...::   
  Rat   358 IQS----YQRMPGNAMVRGFRVSYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEK--- 415

  Fly  1356 LPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYD 1420
               .:..|:||..:|...||.||:|||:.||:|:|:::.:|:|. .|||.:..:.:|.:||.|:|
  Rat   416 ---VHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHL-EVHWSLVSVDVRRRTITYFD 476

  Fly  1421 SMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRD 1485
            |....|:.....:.|||..|::.|.:..|.. |:......|:.||.|.||||.|...:.:::...
  Rat   477 SQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQ-GWKGYFKMNVARQNNDSDCGAFVLQYCKHLALS 540

  Fly  1486 VPITFSQAEMLYFRTKMALEIADGKL 1511
            .|.:|:|.:|...|.::..|:...||
  Rat   541 QPFSFTQQDMPKLRRQIYKELCHCKL 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 55/175 (31%)
Senp3NP_001013134.2 Peptidase_C48 394..566 CDD:280975 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106177335
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.