DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp6

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001100312.2 Gene:Senp6 RGDID:1304565 Length:1135 Species:Rattus norvegicus

Alignment Length:776 Identity:149/777 (19%)
Similarity:254/777 (33%) Gaps:273/777 (35%)


  Fly   858 SRESETDSTDTG-------------TGFQAQNGKGFGAGRQPENSFLSQKRRNQEENPR------ 903
            :|.||..:|.:|             .||:...|...|......|..||       ||.:      
  Rat    69 NRRSEIVATSSGDFILKTYVRRNKTDGFKTLKGNAIGLNMLSNNKKLS-------ENTQATALCS 126

  Fly   904 --LIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPT 966
              ::..||..::..::...:||.....:....|...|...|   ..|.||...|....|  ||..
  Rat   127 GTVVHGRRFHHAHVQMPGIKTAAQSNQDRKERKEYPPHVHK---AENNPVMLSHGQGGD--HVMK 186

  Fly   967 PFDDEE-----------------SSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVR 1014
            ..:|.|                 |:.:|:...|:|:..       |.|..:||.|.........:
  Rat   187 KTEDSESYVEPEVKRKVQQKRHCSTYQLSPLSPASKKC-------LTHFEVSEQRECCPKCGKEK 244

  Fly  1015 REPSRLHR-SILSH---EMNCKDQEQYNE----LIRTQTNYVGSRYLKPGTPPTFQRAKAQSATS 1071
            ...:|... .|:.|   :.||:.....||    |:||..:               |.:..|.:.:
  Rat   245 ENQTRCQSCGIVFHNDLQRNCRQAVTLNESTGPLLRTSIH---------------QNSGGQKSQN 294

  Fly  1072 SSCSLQDNQSNITDSFP----------------------SPHGR----ANP--------ELTEYA 1102
            :..:.:....|..|..|                      .|.|:    .||        :|.:..
  Rat   295 TGLTAKKFYGNSVDKIPIDILLTCDGSRHNYIQTNGKVILPGGKIPKITNPKERKTSVSDLNDPI 359

  Fly  1103 KLINRQENEENR-----SPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKD 1162
            .|.:..:::::|     |.:| ||..:|.:|.|  .||....|:.:.:||    .::.||   :.
  Rat   360 ILSSDDDDDDDRTKRRESTSP-QPADSACSSPA--PSTGKVEAALNANTC----RAEQEP---RS 414

  Fly  1163 SPEVKEANE-------------ANEANEANEANETKENDAPQPTTTRIKKPDFLHRRFANC---- 1210
            ||...|.|.             .|..:...:..:...:.|..|.|: :...|| .....||    
  Rat   415 SPAESELNTVVIPRKARMKDQLGNSISTPLKRRKVNTHGALIPVTS-LSCQDF-GSVILNCRSIR 477

  Fly  1211 ------------------IFLRNDFAENFKARANR-----------RQLESMHLLGI------AE 1240
                              |.:|.|..::.:...|.           |:|..:.|..|      ..
  Rat   478 VGTLFRLLVEPVIFSLELIKIRLDGPDSVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLS 542

  Fly  1241 QQANESKDERL-----------AYEKKLREVMFRSGAPHRP-------------------FFEIG 1275
            .|...||::::           :.|::...::|::|..|:.                   ||...
  Rat   543 LQLQMSKEDKVWNDCKGINRITSLEEQYIILIFQTGLDHQADVVFESIITDIGIRNNVCNFFAKI 607

  Fly  1276 PLEQPEEK------------------KETKL--------IPLTKEDHARFQEMTTIEVTTNLIF- 1313
            |.|:...:                  ||.|:        |.|..:...:|.:.......::.|| 
  Rat   608 PFEEANSRLVACTRSYEESIKGNCVQKENKVKTVSFESKIQLRSKQELQFFDDEEEAGESHTIFI 672

  Fly  1314 --------------KYNLQITTDDIFTFVDGEWLNDAIINFYMSMLT-ERSEKRAGELPATYAMN 1363
                          |..:.:|.:|:....:||:|||.||:||:..|. |:.:|.  :....:..:
  Rat   673 GPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKE--DADRIHIFS 735

  Fly  1364 TFFMPRL---------------LQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII 1409
            :||..||               .|..:..|:.|||.||:|.||.|.||:: ...||.:|::
  Rat   736 SFFYKRLNQRERRNSETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLN-EAAHWFLAVV 795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 31/96 (32%)
Senp6NP_001100312.2 Peptidase_C48 704..>816 CDD:304959 31/96 (32%)
Peptidase_C48 <996..1072 CDD:304959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.