DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_017450802.1 Gene:Senp1 RGDID:1310275 Length:724 Species:Rattus norvegicus

Alignment Length:791 Identity:204/792 (26%)
Similarity:320/792 (40%) Gaps:206/792 (26%)


  Fly   831 KRDLQEDISMGLEILKKIRGMLSGWYSSRESETDSTDTGTGFQAQNGKGFGAGRQPENSFLSQKR 895
            ||...||.:.|:::                      |.|......:...|.|...|.:.|...:.
  Rat    29 KRPEMEDTADGVKM----------------------DAGEVTLVNHSSAFRAHLLPHSGFPEDQL 71

  Fly   896 RNQEENPRLIKYRRVDNSFPRLITNETAEDLI-PN-----------NSMAKRDQPQSSKRLSIFN 948
            ...::  :::.:|:  .:..|..|..|:.... |:           :...||..|.|...|...:
  Rat    72 ALSDQ--QILPFRQ--GTLHRAFTGSTSSAAYNPDYHSGFFVSKMRSPPLKRHNPSSDSFLGSGD 132

  Fly   949 PPVYTQH---RVRNDAPHVPTPFDDEESSQRL-ANAGPSSRPM----TYSDAVRLGHNGISESRV 1005
            ...:.|.   :.||..|...:......:|:.| .....:||..    ..:|:..|.:..:.:|..
  Rat   133 IRTFGQSANGQWRNSTPASGSALQKPRNSRSLYLETRKTSRCRILWNRVTDSCGLSNTFVGKSNH 197

  Fly  1006 NGH-----SSHTVRREPS-----RLHRSILSHEMNCKDQEQY----NELIRTQTNYVGSRYLKPG 1056
            :.|     .|..::..||     ...||:||.:   |.|.::    .|.::.:...:..:.|:..
  Rat   198 HCHVSAYEKSFPIKPAPSPSWSGSCRRSLLSPK---KTQRRHFSTAEETVQEEEKEIYRQLLQMV 259

  Fly  1057 TPPTFQRAKAQS---ATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAP 1118
            |...|..||..:   ...|.| |..|::::.||.                               
  Rat   260 TGKQFSVAKPTTHFPLHLSRC-LSSNKNSLKDSL------------------------------- 292

  Fly  1119 QQPKRNASNSSASH--ASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEV--------------- 1166
               .|| .||.|||  .|..|||.|:|..|... ..|.:...|:..:|:|               
  Rat   293 ---LRN-GNSCASHVIGSDTSSSGSASILTAQE-QLSHSAHSLISGTPDVAFGSKDSALHHHLSA 352

  Fly  1167 -------KEANEANEANEANEANETKENDAPQPTTTRIKKP----------------DFLHRRFA 1208
                   ..:|..:|.:::....:.||:..|   .:|...|                |.|.   :
  Rat   353 PHQPDSLPASNPQSEGSDSVILLKVKESQTP---ASRYLSPLKRSTCPYIIPYSAVTDLLS---S 411

  Fly  1209 NCIFLRNDF-------AENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGA 1266
            :..|.:.:.       ..:.:||...||:|....|.:..|.....:.|....:..  |:..|.  
  Rat   412 SPTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEQEHAVLDSV--ELHLRV-- 472

  Fly  1267 PHRPFFEIGPLEQPEEKKETKLIPLT------KEDHA------RFQEMT-TIEVTTNLIFK---- 1314
                     |||        |.:|:|      |:.|.      .|.|:| .:|.....:|:    
  Rat   473 ---------PLE--------KEVPVTAAQETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQ 520

  Fly  1315 -------YNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQ 1372
                   :.|.||..||.|.....||||.||||||:||.|||:::.  .|:.:|.||||..:|..
  Rat   521 DEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKG--FPSVHAFNTFFFTKLKA 583

  Fly  1373 AGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYL 1437
            |||..|:|||:|||:||.||:.||:|.| ||||:|::..|.|::.||||||..|..|...|::||
  Rat   584 AGYQAVKRWTKKVDVFSVDILLVPIHLG-VHWCLAVVDFRKKSVTYYDSMGGVNNEACRILLQYL 647

  Fly  1438 HEESLDKRKQPFDMTGFVV--ENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRT 1500
            .:||:||:::.||..|:.:  :.:|.||:|.|.||||:|:|.:|:.||:|.||.|:|..|.|||.
  Rat   648 KQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRK 712

  Fly  1501 KMALEIADGKL 1511
            :|..||...||
  Rat   713 RMVWEILHRKL 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 90/177 (51%)
Senp1XP_017450802.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.