DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and SENP1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_016874718.1 Gene:SENP1 HGNCID:17927 Length:707 Species:Homo sapiens

Alignment Length:871 Identity:221/872 (25%)
Similarity:332/872 (38%) Gaps:243/872 (28%)


  Fly   716 PLPPAEAQPGSTSEDISDPVSPEHWEQLESLDPSTICIRKTFNLIRDISESLVADPEQPEAEAHR 780
            ||......|||:                    |..:||           .:.|:|.::.|.|...
Human     4 PLTATICLPGSS--------------------PPGLCI-----------FAKVSDVKRLEMETRF 37

  Fly   781 KSIFLLRQKLADVCHKVLTEIIHGRATDEIISILR------EILEQTKEIPPRPTPKRDLQED-I 838
            ..|.....:|....|...:.......||:|...:|      .::...........|:....|| :
Human    38 CLISQAGLELLGSSHSSASASQSASITDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQL 102

  Fly   839 SMG-LEILKKIRGMLS--------------GWYS---SRESETDSTDTGTGFQAQNGKGFGAGRQ 885
            |:. .:||...:|.|.              .:||   |.:|...|.|..|..|:.||:  .....
Human   103 SLSDQQILSSRQGHLDRSFTCSTRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQ--WRNST 165

  Fly   886 PENSFLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPP 950
            |.:|...||.||...     .|         |.|.:|:..|  :||.|.:               
Human   166 PSSSSSLQKSRNSRS-----LY---------LETRKTSSGL--SNSFAGK--------------- 199

  Fly   951 VYTQHRVRNDA-----PHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSS 1010
              :.|.....|     |..|.|......|.|.:...|..                ::.|....:.
Human   200 --SNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKK----------------TQRRHVSTAE 246

  Fly  1011 HTVRREPSRLHRSILS------------------HEMNCKDQEQYNELIRTQTNYVGSRYLKPGT 1057
            .||:.|...::|.:|.                  |...|         :.:..|.:.....|.|.
Human   247 ETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRC---------LSSSKNTLKDSLFKNGN 302

  Fly  1058 PPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPK 1122
            ....|...:.:::|.|.|:..||..::.|..| .....|::...:|......:..:....|.||.
Human   303 SCASQIIGSDTSSSGSASILTNQEQLSHSVYS-LSSYTPDVAFGSKDSGTLHHPHHHHSVPHQPD 366

  Fly  1123 RNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKEN 1187
            ..|::::.|                   ..||:..:|                       :.|::
Human   367 NLAASNTQS-------------------EGSDSVILL-----------------------KVKDS 389

  Fly  1188 DAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERL- 1251
            ..|.|::|..:...::....:         ..:.:||...||:|....|.:  |..|:...||. 
Human   390 QTPTPSSTFFQAELWIKELTS---------VYDSRARERLRQIEEQKALAL--QLQNQRLQEREH 443

  Fly  1252 ----AYEKKLREVMFRSGAPHRPFFEIGPLE--------QPEEKKETKLIPLTKEDHARFQEMT- 1303
                :.|..||.                |||        |..:||..||  ...||  .|.|:| 
Human   444 SVHDSVELHLRV----------------PLEKEIPVTVVQETQKKGHKL--TDSED--EFPEITE 488

  Fly  1304 TIEVTTNLIFK-----------YNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELP 1357
            .:|.....:|:           :.|.||..||.|.....||||.||||||:||.|||:::.  ||
Human   489 EMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKG--LP 551

  Fly  1358 ATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSM 1422
            :.:|.||||..:|..|||..|:|||:|||:||.||:.||:|.| ||||:|::..|.|.|.|||||
Human   552 SVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLG-VHWCLAVVDFRKKNITYYDSM 615

  Fly  1423 GRPNQPALDALVKYLHEESLDKRKQPFDMTGFVV--ENAQNIPRQGNSSDCGVFSCMFAEYITRD 1485
            |..|..|...|::||.:||:||:::.||..|:.:  :.:|.||:|.|.||||:|:|.:|:.||:|
Human   616 GGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKD 680

  Fly  1486 VPITFSQAEMLYFRTKMALEIADGKL 1511
            .||.|:|..|.|||.:|..||...||
Human   681 RPINFTQQHMPYFRKRMVWEILHRKL 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 92/177 (52%)
SENP1XP_016874718.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130206
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.