DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp7

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_006248306.1 Gene:Senp7 RGDID:1305510 Length:1043 Species:Rattus norvegicus

Alignment Length:1040 Identity:190/1041 (18%)
Similarity:325/1041 (31%) Gaps:408/1041 (39%)


  Fly   712 EVSTPLPPAEAQPGSTSEDISDPV---SPEHWEQLESLDPSTICIRKTFNLIRDISESLVADPEQ 773
            |....||..:|:...||:..||.:   |.:..|..:.|||    :.::.||...|...::.|   
  Rat   112 EFRKTLPRNDAKLCDTSKVQSDSLPSTSVDSIETCQRLDP----LHQSLNLSERIPRVILTD--- 169

  Fly   774 PEAEAHRKSIFLLRQKLADVCHKVLTEIIHGRATDEIISILREILEQTKEIPPRPTPK-RDLQED 837
                        :||          ||:  ||...:|.|:....|..|      .:|| .:|...
  Rat   170 ------------IRQ----------TEL--GRKYLKIPSVTEASLSDT------ASPKSEELSSS 204

  Fly   838 ISMGLEILKKIRGMLSGWYSSRESETDSTDTGTGFQAQNGKGFGAGRQPENSFLSQKRRNQEENP 902
            ....||..:.: ..|..:.|.|.|:...|...:..:|.||                 |:.|.::.
  Rat   205 ADGSLESCQNV-NHLKSFLSERGSKPSRTGDISAKEAANG-----------------RQEQGDDG 251

  Fly   903 RLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTP 967
            .:.         |.::|.: ::|....|.....::..|:|..|      |:    .::..|.|. 
  Rat   252 DIA---------PEMVTPQ-SKDFNSGNKGDYHEEGTSNKNTS------YS----HSETDHTPV- 295

  Fly   968 FDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREPSRLHRSILSHEMN-- 1030
                  |::....|                      |.|.|:||..:....:....|...|..  
  Rat   296 ------SRKRKKRG----------------------RSNFHNSHNPKSSVDKSTEYIKEEENEST 332

  Fly  1031 -CKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRA 1094
             ....|:.||          ..:..|..|........::..::.||....:.:::    :..|||
  Rat   333 VSSKLEESNE----------DSHQDPAPPEGLTPDSLETEATNVCSFVVQEPDVS----AASGRA 383

  Fly  1095 -NPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPM 1158
             :|             |:.:.|....:...|:|.:....|||:..:....       .:|:...:
  Rat   384 CSP-------------NKSSESSVSSEVAENSSAAEKGEASTVKEAPPPG-------GNSEENQL 428

  Fly  1159 LVKDSPEVKEANEANEANEANEA-------------NETKENDAPQ------------------- 1191
            |:...|.|..::|.......|..             :|.:....||                   
  Rat   429 LMSAEPIVVSSDEEGPVEHKNSVILKLQPSQDYEFMSENQTTSDPQLSELMLGACESVQVSSELC 493

  Fly  1192 -------------PTTTRIKKPDFLHRRFANCIFLRN---------DFAENF------------- 1221
                         |.:....|.||:.    .|:::..         .|.:.:             
  Rat   494 PYNPDMENISCINPNSEMDLKLDFIF----TCVYIGKIKGTSKGCITFTKKYIKIPFQVSMNEIS 554

  Fly  1222 ----KARANRRQL--------------------ESMHLLGIAEQQAN-----ESKDERLAY---- 1253
                .||..|..|                    .|.:|..|..|..|     :||.....:    
  Rat   555 LTVDTARLKRFGLWESKDDDHSKRSHAILFLWVSSNYLQDIQTQLENPMLSQQSKANEFIFLELN 619

  Fly  1254 -------EKKLREVMFRSGAPH--------RPFFEIGPLEQ---PEE------------------ 1282
                   |.||:::|...||.:        .|:.:..||.|   |:|                  
  Rat   620 SPISQREELKLKDIMMEIGATNGELQLSCPLPWVQAFPLFQDLSPQEISFLHYYCASASSFPAVA 684

  Fly  1283 KKETKLIPLTKEDHARFQEMT------------TIEVTTN-----------------LIF----- 1313
            ..:.|..|:::..:|...:.|            ::.:|::                 :::     
  Rat   685 GADMKKKPVSQPSNADVVKPTYTFLHKQSSGCYSLSITSSPDEEWREVRNTGPVQKLIVYPPPPT 749

  Fly  1314 KYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGEL-PATYAMNTFFMPRL------- 1370
            |..|.:|.:|:....:||:|||.||:||:..|.  .||.:.|| ..::..::||...|       
  Rat   750 KGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLL--LEKASDELVERSHIFSSFFYKCLTRKENNL 812

  Fly  1371 ---------LQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII----------------- 1409
                     .|..:..||.|||.:::|:||.|.|||: .:.||.:|:|                 
  Rat   813 TEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVN-ESSHWYLAVICFPWLEEAVYEDFPQTV 876

  Fly  1410 ----------HLRNKT------------------------------------IFYYDSMGRPN-Q 1427
                      | .|||                                    |...||:...: |
  Rat   877 SQEFQDQQSQH-DNKTIDNDPHTTSTVFTSAEESQSTETSMSVPKKMCKRPCILILDSLKAASIQ 940

  Fly  1428 PALDALVKYLHEESLDKRK--QPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITF 1490
            ..:..|.:||..|...|||  :.|..|. :|:....:|:|.|||||||:...:.|...:|..:.|
  Rat   941 NTVQNLREYLEVEWEVKRKTHREFSKTN-MVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNF 1004

  Fly  1491  1490
              Rat  1005  1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 63/244 (26%)
Senp7XP_006248306.1 Peptidase_C48 767..1004 CDD:304959 62/242 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.