DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and SENP3

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_056485.2 Gene:SENP3 HGNCID:17862 Length:574 Species:Homo sapiens

Alignment Length:666 Identity:134/667 (20%)
Similarity:230/667 (34%) Gaps:165/667 (25%)


  Fly   875 QNGKGFGAGRQPENSFLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQ 939
            ::|.|||.  .|.:......||.....|          ||....:.|..|:      ..:.|:.:
Human    43 KSGGGFGP--DPGSGTTVPARRLPVPRP----------SFDASASEEEEEE------EEEEDEDE 89

  Fly   940 SSKRLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESR 1004
            ..:..:...||.::|... :..|....|...:..|||...|..:.|.:.||.:..|..:.....|
Human    90 EEEVAAWRLPPRWSQLGT-SQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGR 153

  Fly  1005 VNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSA 1069
            ..|             .|..|:|..|                     :|.|      |:..|...
Human   154 HRG-------------RRRGLAHPKN---------------------HLSP------QQGGATPQ 178

  Fly  1070 TSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHAS 1134
            ..|.|.          .|.||.|...|.|.....|: .::......|.|..|.........:..|
Human   179 VPSPCC----------RFDSPRGPPPPRLGLLGALM-AEDGVRGSPPVPSGPPMEEDGLRWTPKS 232

  Fly  1135 TIS-SSASSSCS-------------------------TCSTCSSSDTEPMLVKDSPEVKEANEAN 1173
            .:. .|...||:                         ..:.||..|      ..:.|:.:.::..
Human   233 PLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGD------HVAQELFQGSDLG 291

  Fly  1174 EANEANEANETKENDAPQPTTTRIKKPDFLHRRFANCI-FLRNDFAENFKARANRRQLESMHLLG 1237
            .|.||....|.....:|            |......|: .:.::|.:.:.:           |:.
Human   292 MAEEAERPGEKAGQHSP------------LREEHVTCVQSILDEFLQTYGS-----------LIP 333

  Fly  1238 IAEQQANESKDERLAYEKKLREVMFRS-GAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQE 1301
            ::..:..|          ||.::..:. ..|.|....:..::.                   :|.
Human   334 LSTDEVVE----------KLEDIFQQEFSTPSRKGLVLQLIQS-------------------YQR 369

  Fly  1302 MTTIEVTTNLIFKYNLQI-TTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTF 1365
            |....:.......|...: |.||:.|.....||||.::|.|..::.:...::      .:..|:|
Human   370 MPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEK------VHFFNSF 428

  Fly  1366 FMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPAL 1430
            |..:|...||.||:|||:.||:|:|:::.:|:|. .|||.:..:.:|.:||.|:||....|:...
Human   429 FYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHL-EVHWSLISVDVRRRTITYFDSQRTLNRRCP 492

  Fly  1431 DALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEM 1495
            ..:.|||..|::.|.:..|.. |:......|:.||.|.||||.|...:.:::....|.:|:|.:|
Human   493 KHIAKYLQAEAVKKDRLDFHQ-GWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDM 556

  Fly  1496 LYFRTKMALEIADGKL 1511
            ...|.::..|:...||
Human   557 PKLRRQIYKELCHCKL 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 55/175 (31%)
SENP3NP_056485.2 Nuclear localization signal. {ECO:0000255} 125..128 1/3 (33%)
Nuclear localization signal. {ECO:0000255} 153..159 3/19 (16%)
Protease 386..543 53/165 (32%)
Peptidase_C48 400..572 CDD:280975 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106177168
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.