DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and SENP6

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_056386.2 Gene:SENP6 HGNCID:20944 Length:1112 Species:Homo sapiens

Alignment Length:930 Identity:187/931 (20%)
Similarity:322/931 (35%) Gaps:265/931 (28%)


  Fly   570 EQLTPEDQEEDQHYLNFEGNQQFQLQKQDQ----------LSVPQIQKQTHQFESKVKK-RKLQP 623
            |.|...:.:.|.   .|:.|..|..:::.:          |||.:.:      :|:..| :||..
Human    17 EALARSESKRDG---GFKNNWSFDHEEESEGDTDKDGTNLLSVDEDE------DSETSKGKKLNR 72

  Fly   624 FSEYQQKGQKDHIQERQYIQQEFTIHSNQAYSKVQYIQTIQTATPYVPQLEISQENSFEVQPAYE 688
            .||.......:.|. :.|:::          :|.:..:|:: ..|.  .|.:...|.       :
Human    73 RSEIVANSSGEFIL-KTYVRR----------NKSESFKTLK-GNPI--GLNMLSNNK-------K 116

  Fly   689 VNEGQRDRELVSYT-------GHEHQNFVDEVSTPLPPAEAQPGSTSEDISDPVSPEHWEQLESL 746
            ::|..::..|.|.|       .|.|      ...|:....||.....::..:  .|.|.:::| :
Human   117 LSENTQNTSLCSGTVVHGRRFHHAH------AQIPVVKTAAQSSLDRKERKE--YPPHVQKVE-I 172

  Fly   747 DPSTIC-IRKTFNLIRDISESLVADPEQPEAEAHRKSIFLLRQKLADVCHKVLTEIIHGRATDEI 810
            :|..:. ::....:::...||    ..|.|.|..||    ::||                     
Human   173 NPVRLSRLQGVERIMKKTEES----ESQVEPEIKRK----VQQK--------------------- 208

  Fly   811 ISILREILEQTKEIPPRPTPKRDLQEDISMGLEILKKIRGMLSGWYSSRESETDSTDTG----TG 871
                |.........|..|..|:.|..     ||.|::         :.|::.|.:..||    |.
Human   209 ----RHCSTYQPTPPLSPASKKCLTH-----LEDLQR---------NCRQAITLNESTGPLLRTS 255

  Fly   872 FQAQNGKGFGAGRQPENSFLSQKR---RNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMA 933
            ....:|     |::.:|:.|:.|:   .|.|:.|..|.....|:....|.||  .:.::|...:.
Human   256 IHQNSG-----GQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQTN--GKVILPGAKIP 313

  Fly   934 KRDQPQSSK-RLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGH 997
            |....:..| .||..|.|:            :.:..||:::.:.......|.:|...:.:.....
Human   314 KITNLKERKTSLSDLNDPI------------ILSSDDDDDNDRTNRRESISPQPADSACSSPAPS 366

  Fly   998 NGISESRVNGHSSHTVRR-----EPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGT 1057
            .|..|:.:|.::....|.     |.|.|:...|..:...|||.. |.:|.|.   :..|.:....
Human   367 TGKVEAALNENTCRAERELRSIPEDSELNTVTLPRKARMKDQFG-NSIINTP---LKRRKVFSQE 427

  Fly  1058 PPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINR----------QENEE 1112
            ||.   |.|.|..||..|:..|..:|...            |.:..||..          |.:|.
Human   428 PPD---ALALSCQSSFDSVILNCRSIRVG------------TLFRLLIEPVIFCLDFIKIQLDEP 477

  Fly  1113 NRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEV----------- 1166
            :..|                ...|.:  :|..:.|..|:......:.::..|.|           
Human   478 DHDP----------------VEIILN--TSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSIQLQMN 524

  Fly  1167 KEANEANEANEANEANETKEN----------DAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENF 1221
            ||....|:....|:....:|.          |.|         .:.:.....|.|.::|:.: ||
Human   525 KEDKVWNDCKGVNKLTNLEEQYIILIFQNGLDPP---------ANMVFESIINEIGIKNNIS-NF 579

  Fly  1222 KAR-----ANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPE 1281
            .|:     ||.|      |:..........|......|.|::.|.|.|....|...|....::.|
Human   580 FAKIPFEEANGR------LVACTRTYEESIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEE 638

  Fly  1282 EKKETKLIPLTKEDHARFQEMTTIEVTTNLIF------KYNLQITTDDIFTFVDGEWLNDAIINF 1340
            |         |.|:|..|     |.....||.      |..:.:|.:|:....:||:|||.||:|
Human   639 E---------TGENHTIF-----IGPVEKLIVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDF 689

  Fly  1341 YMSMLT-ERSEKRAGELPATYAMNTFFMPRL---------------LQAGYAGVRRWTRKVDLFS 1389
            |:..|. |:.:|.  :....:..::||..||               .|..:..|:.|||.||:|.
Human   690 YLKYLVLEKLKKE--DADRIHIFSSFFYKRLNQRERRNHETTNLSIQQKRHGRVKTWTRHVDIFE 752

  Fly  1390 KDIIPVPVHCGNVHWCMAII 1409
            ||.|.||:: ...||.:|::
Human   753 KDFIFVPLN-EAAHWFLAVV 771

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064 2/10 (20%)
Peptidase_C48 1331..1506 CDD:280975 31/96 (32%)
SENP6NP_056386.2 Protease 666..1112 34/110 (31%)
Peptidase_C48 680..>825 CDD:304959 31/96 (32%)
Peptidase_C48 <973..1049 CDD:304959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.