DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ulp1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_595975.1 Gene:ulp1 PomBaseID:SPBC19G7.09 Length:568 Species:Schizosaccharomyces pombe

Alignment Length:601 Identity:170/602 (28%)
Similarity:258/602 (43%) Gaps:143/602 (24%)


  Fly   984 SRPMTYSDAVRLGHNGISE-SRVNGH------SSHTVRREPS-RLHRSILSHEMNCKDQEQYNEL 1040
            ||.:||: .:.|....||| .|:.|.      :|...:.||| :...|..|| :|.|.:..|   
pombe    39 SRTVTYA-KLFLTKTPISELDRIAGEAIPSNSNSTNSKLEPSTKAPESRFSH-INSKTERGY--- 98

  Fly  1041 IRTQTNYVGSRYLKPGTPPTFQRAKAQSATSSS--------CSLQD--------NQSNITDSFPS 1089
            :..:::......|...:.||.    :.|.|:||        .:||:        :..||.|...|
pombe    99 VTVESDMSSHNTLDRNSKPTV----SHSYTNSSKDEKFLDPIALQNLFSPASDTHSQNIHDEALS 159

  Fly  1090 PHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSD 1154
            |                 .....:||....:|.|::.|.|.|:...::....::.||.|..:|. 
pombe   160 P-----------------SSFRVSRSRYFPRPHRSSKNLSVSNRLQLAVFKETTSSTLSHGNSV- 206

  Fly  1155 TEPMLVKDSPEVKEANEANEANEANEANETK--------ENDAPQP------------------- 1192
                               ||:|.|..|.|.        .|.:|.|                   
pombe   207 -------------------EADEINSFNPTPFSSSPLHFTNSSPNPNSDIVTPDKQLDVVSEHAR 252

  Fly  1193 -------TTTRIKKPDFLHRRFANCIFLRNDF--AENFKARANRRQLESMHLL--GIAEQQANES 1246
                   .|.|.|.|.....|.|:..|:::|.  |.|. ..::.:..:|:.||  .:.|:|....
pombe   253 YKHLPFTATLRKKSPHDSTSRKASFRFVQSDQQPARNI-VTSDIQNEKSLLLLIRDLKEKQTESF 316

  Fly  1247 KDERLAYEKKLREVMFR-------SGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTT 1304
            :|        ..||.|.       |..|.||.| |..||.|:..::..|..|.:.:        :
pombe   317 QD--------WNEVDFLQLKGLEISPPPTRPKF-IPELEFPDNARKRALKYLNQSN--------S 364

  Fly  1305 IEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPR 1369
            :..:..:|.|:|:.||..|:.|..:.:||||.:|||||::::||| |....||..:..||||...
pombe   365 VSSSEPIITKFNIPITLKDLHTLRNRQWLNDEVINFYMNLISERS-KIDSSLPRVHGFNTFFYTS 428

  Fly  1370 LLQAGYAGVRRWTRK--VDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSM-GRPNQPALD 1431
            |.:.||||||||.:|  |::...|.:.:|||. :||||||:|:...|...|:||: |.|.: ..|
pombe   429 LQRRGYAGVRRWAKKARVNIADMDAVFIPVHL-DVHWCMAVINKSKKRFEYWDSLAGSPGK-VFD 491

  Fly  1432 ALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEML 1496
            .|..|...|:    |...|::.:......|.|||.|..|||||:|..||.::|:||:.|||.:|.
pombe   492 LLRDYYIAET----KGAVDVSDWENFMDDNSPRQRNGHDCGVFACKTAECVSRNVPVQFSQNDMP 552

  Fly  1497 YFRTKMALEIADGKLW 1512
            ..|.|||..|.|.:::
pombe   553 ELRIKMAASIIDAQIY 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 77/178 (43%)
ulp1NP_595975.1 ULP1 1..568 CDD:227489 170/600 (28%)
Peptidase_C48 391..562 CDD:280975 77/178 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T631580
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.