DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and AF366264

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_694733.3 Gene:AF366264 MGIID:2667157 Length:502 Species:Mus musculus

Alignment Length:652 Identity:157/653 (24%)
Similarity:251/653 (38%) Gaps:179/653 (27%)


  Fly   881 GAGRQPENSFLSQKRRNQEENPRLI---------KYRRVDNS-----FPRLITNETAEDLIPNNS 931
            |...:||.|.:.|.|:..:|:...|         |.:..|.|     .|.....:|:::  |.:.
Mouse     8 GLEMKPEASAIGQTRKYHDESGTEIESEALGQEPKRKCQDGSGMVFKEPGKAQKKTSQE--PQDL 70

  Fly   932 MAKRDQPQSSKRLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLG 996
            ...|:||              ::.:||......|......|.::     ||..:.:|        
Mouse    71 ELPREQP--------------SKGQVRKPQGKTPKQLKPLELTE-----GPPEQAVT-------- 108

  Fly   997 HNGISESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTF 1061
                .....:|...|   :.|    .|::........:|:|..|::                   
Mouse   109 ----GRKPADGGKGH---KRP----YSVMEENEQSPQKEKYGRLLQ------------------- 143

  Fly  1062 QRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNAS 1126
                         .||.:|...:|..     |.:|.||...|:...:..:.:.|      :|..|
Mouse   144 -------------HLQCDQDVRSDQH-----RPHPILTNTWKIKGGESGDSHGS------ERIQS 184

  Fly  1127 NSSASHAST----ISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKEN 1187
            |...|..:.    :|......|.:...|.:.             |:.....|....|    :.|.
Mouse   185 NREPSTVAALKECLSPEGREKCCSEEKCVTE-------------KKGCVKGEGRRGN----SLEP 232

  Fly  1188 DAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLA 1252
            |.|:              .:|..|.   |.........|:..:.:.....|.:|......|:.|.
Mouse   233 DLPE--------------TWAQIIL---DSGRGNSLLPNKVAVLAAEKKPITDQGKGRKMDQILD 280

  Fly  1253 YEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNL 1317
            ..                       |..|::.|..|.|..:|           |:.::   ::.|
Mouse   281 IS-----------------------EDMEKEIENALGPGPQE-----------EILSS---RFKL 308

  Fly  1318 QITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWT 1382
            ||:..||.|..:|:||||.:|||||::|.||:|.:.  .||.:..:|||.|:|..:||:.|:|||
Mouse   309 QISRGDIQTLENGQWLNDEVINFYMNLLVERNENQG--YPALHVFSTFFYPKLKHSGYSSVKRWT 371

  Fly  1383 RKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRK- 1446
            |.::||.|::|.||:| ..|||.:.:|.||.::|.|.||||:..:...:.:.:||..||..:|. 
Mouse   372 RGINLFEKELILVPIH-QRVHWSLVVIDLRKRSIVYLDSMGQTGKSICETIFQYLQNESKTRRNI 435

  Fly  1447 --QPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADG 1509
              .|.:.....| .::.||.|.|.||||||:|.:|:||.||.|:||||..|..||.:|..||...
Mouse   436 ELDPLEWKQCSV-TSEEIPLQLNGSDCGVFTCKYADYIARDQPVTFSQQHMPTFRKRMVWEILHS 499

  Fly  1510 KL 1511
            :|
Mouse   500 QL 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 79/178 (44%)
AF366264NP_694733.3 Peptidase_C48 <279..497 CDD:304959 95/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130979
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.880

Return to query results.
Submit another query.