DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_006520943.1 Gene:Senp1 MGIID:2445054 Length:698 Species:Mus musculus

Alignment Length:762 Identity:212/763 (28%)
Similarity:316/763 (41%) Gaps:202/763 (26%)


  Fly   859 RESETDSTDTGTGFQA------QNGKGFGAGRQPENSFLSQKRRNQEENPRLIKYRRVDNSFPRL 917
            :..|.|.|..|....|      .:|..|...|.|::.|..::....::.....:...:|.||   
Mouse    29 KRPEMDDTADGVKMDAGEVTLVNHGSTFRTHRPPQSGFPEEQLLLSDQQSLPFRQGTLDGSF--- 90

  Fly   918 ITNETAEDLIPNNSMAKR-----DQPQSSKRLSIFNPPVYTQH---RVRNDAPHVPTPFDDEESS 974
             |..|       .|.|.|     |.|.|...|...:...:.|.   :.||..|            
Mouse    91 -TCST-------RSPAYRPDYHSDNPSSDSFLGSGDVRTFGQSANGQWRNSTP------------ 135

  Fly   975 QRLANAGPSSRPMTYSD---AVRLGHNGISESRVNGHSSH-----------TVRREPS-----RL 1020
               |:.....:|.....   ..|...:|:|.:.| |.|:|           .::..||     ..
Mouse   136 ---ASGSAPQKPRNSRSLCLETRKTSSGLSNTFV-GKSNHHCHMSAYEKSFPIKPAPSPSWSGSC 196

  Fly  1021 HRSILS-------HEMNCKD--QEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSATSSSCSL 1076
            .||:||       |....::  ||:..|:.|.....|..:......|.|....:.     |.| |
Mouse   197 RRSLLSPKKTQRRHFSTAEETVQEEEKEIYRQLLQMVTGKQFCVAKPTTHFPLRL-----SRC-L 255

  Fly  1077 QDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASH--ASTISSS 1139
            ..|::::.||.                                  .|| .||.|||  .|..|||
Mouse   256 SSNKNSLKDSL----------------------------------LRN-GNSCASHVIGSDTSSS 285

  Fly  1140 ASSSCSTCS-----------------TCSSSDTEPMLVKDSPEVKEANEANEANEANEANET--- 1184
            .|:|..|..                 ...|.|::|.....:|.  :.|....:|..:|.:::   
Mouse   286 GSASILTAQEQLSHSAHSLSSGTPDVAFGSKDSDPHHHLAAPH--QPNSLPASNTQSEGSDSVIL 348

  Fly  1185 ---KENDAPQPTTTRIKKPDFLHRR-------FANCIFLRNDFAENFKARANRRQLESMH----- 1234
               ||:..|   .:|...|  |.||       ::..:.|.:.....|:|....::|.|::     
Mouse   349 LKVKESQTP---ASRYLSP--LKRRSCPYIIPYSAVMDLLSSSPTFFQAELWIKELTSVYDSRAR 408

  Fly  1235 --LLGIAEQQ--ANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLT--- 1292
              |..|.||:  |.:.:::||   ::....:..|...|        |..|.||:    ||:|   
Mouse   409 ERLRRIEEQKALALQLQNQRL---QEQEHAVLDSVELH--------LRVPLEKE----IPVTAAQ 458

  Fly  1293 ---KEDHA------RFQEMT-TIEVTTNLIFK-----------YNLQITTDDIFTFVDGEWLNDA 1336
               |:.|.      .|.|:| .:|.....:|:           :.|.||..||.|.....||||.
Mouse   459 ETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDE 523

  Fly  1337 IINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGN 1401
            ||||||:||.|||:::.  .|:.:|.||||..:|..|||..|:|||:|||:||.||:.||:|.| 
Mouse   524 IINFYMNMLMERSKEKG--FPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLG- 585

  Fly  1402 VHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVV--ENAQNIPR 1464
            ||||:|::..|.|:|.||||||..|..|...|::||.:||:||:::.||..|:.:  :.:|.||:
Mouse   586 VHWCLAVVDFRRKSITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQ 650

  Fly  1465 QGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            |.|.||||:|:|.:|:.||:|.||.|:|..|.|||.:|..||...||
Mouse   651 QMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKL 697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 91/177 (51%)
Senp1XP_006520943.1 Peptidase_C48 <474..696 CDD:304959 103/225 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130979
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.