DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and Senp6

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_001298039.1 Gene:Senp6 MGIID:1922075 Length:1139 Species:Mus musculus

Alignment Length:960 Identity:184/961 (19%)
Similarity:333/961 (35%) Gaps:306/961 (32%)


  Fly   576 DQEEDQHYLNFEGNQQFQLQKQDQ----------LSVPQIQKQTHQFESKVKK-RKLQPFSEYQQ 629
            |:.|.:....|:.|..|..:::.:          |||       ...:|::.| :||...||...
Mouse    19 DRSESKRDGGFKNNWSFDHEEESEGDADKDGANLLSV-------EDEDSEISKGKKLNRRSEIVA 76

  Fly   630 KGQKDHIQERQYIQQEFT---------------IHSNQAYSKVQYIQTIQTA-----TPYVPQLE 674
            ....|.|. :.|:::..|               :.:|:..|:    .|..||     ..:..:..
Mouse    77 TSSGDFIL-KTYVRRSKTDGFKTLKGNPIGLNMLSNNKKLSE----STAGTALCSGTVVHGRRFH 136

  Fly   675 ISQENSFEVQPAYEVNEGQRDRELVSYTGHEHQNFVDEVSTPLPPAEAQPGSTSEDISDPVSPEH 739
            .:...:..::.|.:.|:.:::|:  .|..:.|:            ||          :.||...|
Mouse   137 HAHSQTPGIRTAAQSNQDRKERK--EYPPYVHK------------AE----------NSPVMLSH 177

  Fly   740 WEQLESLDPSTICIRKTFNLIRDISESLVADPEQPEAEAHRKSIFLLRQK----------LADVC 794
            .:..:.:      ::||     :.|||.|      |:|..||    ::||          |:...
Mouse   178 GQGGDHI------MKKT-----EESESYV------ESEIKRK----VQQKRHCSTYQLSPLSPAS 221

  Fly   795 HKVLTEIIHGRATDEIISILREILEQTKEIPPRPTPKRDLQEDISMGLEILKKIRGMLSGWYSSR 859
            .|.||.:              |:.||.:..|.....|.:..:..|.|:.....::      .:.|
Mouse   222 KKCLTHL--------------EVSEQREYCPKCGKEKENQTKCQSCGIVFHNDLQ------RNCR 266

  Fly   860 ESETDSTDTG----TGFQAQNGKGFGAGRQPENSFLSQKR---RNQEENPRLIKYRRVDNSFPRL 917
            ::.|.:..||    |.....:|     |::.:|:.|:.|:   .:.::.|..|.....|:....:
Mouse   267 QAVTLNEPTGPLLRTSIHQNSG-----GQKSQNTGLTAKKFYGNSVDKIPIDILVTCDDSRHNYI 326

  Fly   918 ITNETAEDLIPNNSMAKRDQPQSSK-RLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAG 981
            .||  .:.::|...:.|...|:..| .:|..|.|:.           :.:..||::..:......
Mouse   327 QTN--GKVILPGGKIPKLTNPKERKISVSDLNDPII-----------LSSDDDDDDDDRTKRRES 378

  Fly   982 PSSRPMTYSDAVRLGHNGISESRVNGHSSHTVRREP------SRLHRSILSHEMNCKDQEQYNEL 1040
            .|.:|...:.:..:...|..|:.:|..:.. ..:||      ..|:..::..:...|||      
Mouse   379 TSPKPADSACSSPVPSTGKVEAALNADACR-AEQEPRSSPAEPELNTIVIPRKARMKDQ------ 436

  Fly  1041 IRTQTNYVGSRYLKPGTPPTFQRAKAQSATS----SSCSLQDNQSNITDSFPSPHGRANPELTEY 1101
                   :|:....|     .:|.|..|..:    .|.|.|:.:|.|.:.      |:....|.:
Mouse   437 -------LGNSISTP-----LKRRKVNSHAAFIHPMSLSCQNFESVILNC------RSIRVGTLF 483

  Fly  1102 AKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSA------SSSCSTCSTCSSSDTEPMLV 1160
            ..|:              :|...:..|...|.....|..      :|..:.|..|:......:.:
Mouse   484 RLLV--------------EPVIFSLESITIHLDGPESDPVDIILNTSDLTKCEWCNVRKLPVVFL 534

  Fly  1161 KDSPEV-----------KEANEANEANEANEANETKEN----------DAPQPTT---------T 1195
            :..|.|           ||....|:....|.....:|.          |......         .
Mouse   535 QAIPAVYQKLSMQLQMSKEDKVWNDCKGINRITSLEEQYIILIFQTGLDHQAEVVFESIITDIGI 599

  Fly  1196 RIKKPDFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKL--- 1257
            |...|:|    ||..:|   |.|.:......|...||  :.|...|:  |:|.:.:::|.|:   
Mouse   600 RNNVPNF----FAKILF---DEANSRLVACTRSYEES--IKGNCAQK--ENKVKTVSFESKIQLR 653

  Fly  1258 --REVMF-----RSGAPHRPFFEIGPLEQPEEKKETKLI-----PLTKEDHARFQEMTTIEVTTN 1310
              :|:.|     .:|..|..|  |||:|        |||     |.                   
Mouse   654 SKQELQFFDDDEEAGESHTIF--IGPVE--------KLIVYPPPPA------------------- 689

  Fly  1311 LIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLT-ERSEKRAGELPATYAMNTFFMPRL---- 1370
               |..:.:|.:|:....:||:|||.||:||:..|. |:.:|.  :....:..::||..||    
Mouse   690 ---KGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKE--DADRIHIFSSFFYKRLNQRE 749

  Fly  1371 -----------LQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII 1409
                       .|..:..|:.|||.||:|.||.|.||:: ...||.:|::
Mouse   750 RRNPETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLN-EAAHWFLAVV 798

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064 2/4 (50%)
Peptidase_C48 1331..1506 CDD:280975 31/96 (32%)
Senp6NP_001298039.1 Protease 693..1139 34/110 (31%)
Peptidase_C48 707..>819 CDD:304959 31/96 (32%)
Peptidase_C48 <999..1075 CDD:304959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.