DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and SENP5

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_689912.2 Gene:SENP5 HGNCID:28407 Length:755 Species:Homo sapiens

Alignment Length:846 Identity:175/847 (21%)
Similarity:297/847 (35%) Gaps:253/847 (30%)


  Fly   751 ICIRKTFNLIRDISESLVADPEQPEAE---AHRKSIFLLRQKLADVCHKVLTEIIHGRATDEIIS 812
            :|.:..||:......:|.:..::.:|:   :..|::..|:      ..|:|:.   .:.:|....
Human    76 LCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKTLLRLQ------AEKLLSS---AKNSDHEYC 131

  Fly   813 ILREILEQTKEIP------------PRPTPKRDLQEDISMGLEILKKIRGMLSGWYSSRESETDS 865
            ..:.:|:...:.|            ||..|:   ..|..|      |..|         ||::..
Human   132 REKNLLKAVTDFPSNSALGQANGHRPRTDPQ---PSDFPM------KFNG---------ESQSPG 178

  Fly   866 TDTGTGFQAQNG---KGF-------------GAGRQPENSFLSQKRR------------------ 896
             ::||.....|.   |||             |....|:...|:|.||                  
Human   179 -ESGTIVVTLNNHKRKGFCYGCCQGPEHHRNGGPLIPKKFQLNQHRRIKLSPLMMYEKLSMIRFR 242

  Fly   897 -------NQEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQ 954
                   :.....::.|.|:...|:.:.:|.:..|        .:|:..:...            
Human   243 YRILRSQHFRTKSKVCKLRKAQRSWVQKVTGDHQE--------TRRENGEGGS------------ 287

  Fly   955 HRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTY-----SDAVRLGHNGISESRVNGHSSHTVR 1014
                      .:||...|...      ||.|...|     |.||..|.|                
Human   288 ----------CSPFPSPEPKD------PSCRHQPYFPDMDSSAVVKGTN---------------- 320

  Fly  1015 REPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPGTPPTFQRAKAQSA-TSSSCSLQD 1078
                       ||..:|..:         .::::|.........|..|...|.:| ..||||...
Human   321 -----------SHVPDCHTK---------GSSFLGKELSLDEAFPDQQNGSATNAWDQSSCSSPK 365

  Fly  1079 NQ-SNITDSFPSPHGRANPEL---TEYAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSS 1139
            .: :.:....|.|..|:|...   ||...:...|||:             .|:.|........|.
Human   366 WECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQ-------------TSSVSDDRVKLSVSG 417

  Fly  1140 ASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRIKKPDFLH 1204
            |.:|.|:.              |.|..::|.:...:.:..|....|::         |...:.|.
Human   418 ADTSVSSV--------------DGPVSQKAVQNENSYQMEEDGSLKQS---------ILSSELLD 459

  Fly  1205 RRFAN--------CIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLA--YEKKLRE 1259
            ..:..        |..|:               ||:....|...|:|:...||:|:  ....|.|
Human   460 HPYCKSPLEAPLVCSGLK---------------LENQVGGGKNSQKASPVDDEQLSVCLSGFLDE 509

  Fly  1260 VMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTT--------NLIFKYN 1316
            ||.:.|:       :.||.:.|.....|  .:..||.:..:.....|:|.        |....||
Human   510 VMKKYGS-------LVPLSEKEVLGRLK--DVFNEDFSNRKPFINREITNYRARHQKCNFRIFYN 565

  Fly  1317 LQITTDDIFTFVDGE-WLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRR 1380
            ..:...|....:||: ||||.:||.|..::.:....:      .:..|:||..:|:..||.||:|
Human   566 KHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDK------VHFFNSFFHRQLVTKGYNGVKR 624

  Fly  1381 WTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKR 1445
            ||:|||||.|.::.:|:|. .|||.:..:.|.|:.|.:|||.|...:..::.:.|||..|:.:|.
Human   625 WTKKVDLFKKSLLLIPIHL-EVHWSLITVTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREKN 688

  Fly  1446 KQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGK 1510
            :..| :.|:.....:.||:|.|.||||||...:.:.:..:.|..|||.:|...|.::..|:.:.:
Human   689 RPEF-LQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECR 752

  Fly  1511 L 1511
            |
Human   753 L 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 60/176 (34%)
SENP5NP_689912.2 Protease 567..724 56/165 (34%)
Peptidase_C48 581..753 CDD:280975 60/180 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.