DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ulp-5

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_491952.1 Gene:ulp-5 WormBaseID:WBGene00006740 Length:311 Species:Caenorhabditis elegans

Alignment Length:228 Identity:59/229 (26%)
Similarity:84/229 (37%) Gaps:78/229 (34%)


  Fly  1329 DGEWLNDAIINFYMS--MLTERSEK--RAGELPATYAMNTFFMPRL----------------LQA 1373
            |...|||.||.|||.  |..|..::  ||    :::..::||:|::                |..
 Worm    46 DRTLLNDTIIEFYMCDWMRLEVFDEATRA----SSHVFHSFFLPKIKTCFKDFKENPPRRSELAN 106

  Fly  1374 GYAGVRRWTRKVDLF-SKDIIPVPVHCGN-VHWCMAIIH----------------LRNKT----- 1415
            .|....|.....:.| .|||:.:|||... .||.:.|:|                ..||.     
 Worm   107 HYNRFFRSKNDAETFLKKDILLIPVHLDKPKHWFLVIVHNPSGAVRRISDVNILDATNKVKSRRL 171

  Fly  1416 -------IFYYDSMGRPNQPALDALV---KYLHEESLDK-RKQPFD------------------M 1451
                   :...::.|......:|:||   ||  .|.:|| ....||                  .
 Worm   172 SRRITGHVNCDENAGECRIIIMDSLVHSKKY--REVIDKTHDSTFDHIRLWLLMSAAATDVDMFC 234

  Fly  1452 TGFVVENAQNIPRQGNSSDCGVFSCMFAEYITR 1484
            |.|.....|.:|:|.||.|||:|...||||.|:
 Worm   235 TRFRKVVCQKLPQQKNSVDCGIFMMAFAEYFTK 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 58/227 (26%)
ulp-5NP_491952.1 Peptidase_C48 50..302 CDD:280975 58/225 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.