DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ulp-1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_498095.3 Gene:ulp-1 WormBaseID:WBGene00006736 Length:697 Species:Caenorhabditis elegans

Alignment Length:786 Identity:207/787 (26%)
Similarity:325/787 (41%) Gaps:194/787 (25%)


  Fly   807 TDEIISILREILEQTKEIPPRPTPKRDLQEDISMGL-EILKKIRGMLSGWYSSRESETDSTDTGT 870
            ||:.::     .|:.::.|.:.|.|..     |.|| .:.....||   :.||...|.:.|:...
 Worm    21 TDQAVT-----NEEKEQSPTKRTRKTK-----SQGLGGLFNTFFGM---FVSSNSGEKEKTEVSG 72

  Fly   871 GFQAQNGKGF---GAGRQ-PENS----FLSQK---RRN--QEENPRLIKYRRVDNSFPRLITNET 922
            ..|.|.....   |..|: .||.    ||::.   |.|  .|||..:|: :.|..:. .:..:|.
 Worm    73 EVQVQEDDEIIVEGTTRRVAENKKYMIFLNEDAPVRANAGSEENEVIIE-KHVQKNV-EIRNDEE 135

  Fly   923 AEDLIPNNSMAKRDQPQSSKRLS--------------IFNPPVYTQHR-------------VRND 960
            .:::..:..:.....|:|.|.|.              :|...|.|.::             ..||
 Worm   136 KQEVQGDLVLTLSSSPKSPKNLEKSFEVQQDDEEPDVLFEKVVKTPNKQLQEARRFQNELIFLND 200

  Fly   961 APHVPTPFDD-----EESSQRLANAGPS---SRPMTYSDAVRLGHNGISESRVNGHSSHTVR--- 1014
            .|..|   ||     :..|:...:..|.   |||:|           .|.|.::.::|:.||   
 Worm   201 NPDTP---DDVSVISDSRSKEFISPTPDDSVSRPIT-----------PSLSSLSNYTSNNVRDYW 251

  Fly  1015 -----REPSRLHRSILSHEM-NCKDQEQYNELI--RTQTNYVGSR-YLKPGTPPTFQ-RAKAQSA 1069
                 ::|..|.|..:.|:. :.....:.|.:|  :...|::.|| .|..|...:.| .|||.|.
 Worm   252 RRNSAKKPEVLRRVPVRHQFKHSTSVRKMNTIIDLKKIKNHLSSRDRLLQGVVASGQYEAKAISG 316

  Fly  1070 TSSSCSLQDNQSNITDSFPSPHGRANPELTEYA-------KLINRQ-----ENEENRSPAPQQPK 1122
            .......:..:::.||..    .||..::.|..       .|::|:     ::||:.|.:.:|..
 Worm   317 IVEKKPKKMQRTSSTDIL----ARAKNKIAELGGSRSNTPSLLSREPSIIIDSEESTSSSYRQHA 377

  Fly  1123 RNASNSSASH--ASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANEANEANEANEANETK 1185
            |:.|:.|.|:  .:.|.|..:|     ....|:...|...::|.::.:..|.....||       
 Worm   378 RSNSSESDSYRKLNDILSQINS-----LGIGSAYRGPQRYQNSYQLSKQKEDKLLEEA------- 430

  Fly  1186 ENDAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESK--D 1248
                      ||::.   ||...     |.|..|:.:.|        :.|.|||.:...|.|  |
 Worm   431 ----------RIREG---HRSQT-----RGDRLEDVRKR--------LELQGIAIRPKVEKKKVD 469

  Fly  1249 ERLAY---EKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTN 1310
            :.:|.   ...|.|..:..|.|:..|.:                                     
 Worm   470 DFMALPDAADALVERAWSGGNPNEQFVD------------------------------------- 497

  Fly  1311 LIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGY 1375
               .:::||...|:.|.....||||.|||||:.::.:||...: :.|..||.||||...::..||
 Worm   498 ---AFSIQICKKDLATLSGLHWLNDEIINFYLQLICDRSNGDS-KYPKIYAFNTFFYSNIVSKGY 558

  Fly  1376 AGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEE 1440
            |.|:|||||||:|:.||:.||||.| :|||||:|.:..|.|.:|||:...|...|.||..||..|
 Worm   559 ASVKRWTRKVDIFAFDIVLVPVHLG-MHWCMAVIDMGEKKIEFYDSLYDGNTAVLPALRGYLEAE 622

  Fly  1441 SLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALE 1505
            ||||:|...:.:|:.::...:||||.|.||||||||.|.|:.:|.....|:|..|.|:|.:|..|
 Worm   623 SLDKKKTAMNFSGWTIQQMTDIPRQQNGSDCGVFSCQFGEWASRRTTPRFTQKNMPYYRKRMVYE 687

  Fly  1506 IADGKL 1511
            |...||
 Worm   688 IVSKKL 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 84/175 (48%)
ulp-1NP_498095.3 Peptidase_C48 <425..692 CDD:304959 112/342 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090255
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T375109
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.647 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.650

Return to query results.
Submit another query.