DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and ulp-2

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_494914.1 Gene:ulp-2 WormBaseID:WBGene00006737 Length:893 Species:Caenorhabditis elegans

Alignment Length:771 Identity:152/772 (20%)
Similarity:278/772 (36%) Gaps:242/772 (31%)


  Fly   877 GKGFG-AGRQPENSFLSQKRRNQEENPRLIKYRRVDNSFPRLITNETA-EDLIPNNSMAKRDQPQ 939
            |:.|| |..|.::..|..:   |:|||.::......:|:.::...:|. :|::.           
 Worm    77 GRDFGIAFNQIDHISLKDE---QQENPAVLICTLNLSSYTKMCKLQTGLKDVVE----------- 127

  Fly   940 SSKRLSIFNPPVYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGISESR 1004
                    .|.:|.:...|| ...:..|::|:              |.|:   |::.:|  .|.|
 Worm   128 --------KPFLYNKSLARN-LTFILKPWNDD--------------PDTF---VKISYN--DEHR 164

  Fly  1005 VNGHS-SHTVRREPSRLHRSILS-HEMNCKDQEQYNELIRTQTN--YVGSRYLKPGTPPTFQRAK 1065
            ...|| .:.|.:  |.:.:.:.: .|.:.|:|.|.    |.||.  |:.|: |...||..:.:..
 Worm   165 EYVHSYDYDVAK--SLMFKEVQAVWEQSLKEQLQR----RHQTGRVYLTSQ-LSEMTPREWVQFL 222

  Fly  1066 A-QSATSSSC---SLQDNQSNITDSFPSPHGRANP------------------------------ 1096
            | |..:...|   |:|  .:.:.|   :||||.:.                              
 Worm   223 ADQKLSKIVCHNGSIQ--YARVED---NPHGRKHTAVATNGFDHRGTRVLNSFGKAHASLATQEK 282

  Fly  1097 ------ELTEYA-KLINRQEN----EENRSPAPQQPKRNAS------------NSSASHASTISS 1138
                  :|||.: |||.|.:.    |.:.:...:.||.|:.            :::.:|.   :|
 Worm   283 SYAKKRKLTEQSLKLIYRNDRSVWLEGSCAKNLKMPKINSEPNMGEFMGWPDMDNAMTHP---TS 344

  Fly  1139 SASSSCSTCSTCSSSD--TEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRIKK-- 1199
            :..:.....||...:|  :...|....|.::..|.|..:.::........||..:..|.:|..  
 Worm   345 NFENEDVMKSTKQPNDFVSFEQLQAPPPVLQRQNGAIYSTQSVAFTHISGNDGVEDLTEKISHLG 409

  Fly  1200 PDFLHRRFANCIFLRNDFAENFKAR-----ANRRQLESMHL---------LGI------AEQQAN 1244
            .:..:...||.:   :.|::|:...     .:....|.:|:         :|.      .:....
 Worm   410 EEAYNIDMANAL---HAFSDNWHYEIHPNTVHNASFEQLHIGDGNSSIGTIGFNPLEPYPQSSFP 471

  Fly  1245 ESKDERLAY-EKKLREVMF---RSGA--PHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQEMT 1303
            :|.:.:.|: :....:|.|   :.|:  |..|...:.|.....||     ||   .|...|....
 Worm   472 QSNNWQQAHGDFTFPQVSFPNTQQGSCLPSTPTAALPPTRPVVEK-----IP---PDTQLFTFPP 528

  Fly  1304 TIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAI----INFYMSMLTERSEKRAGELPATYAMNT 1364
            :...||.:   ..:.:...||.|....|:|||::    :|:...||:....|      :.:..||
 Worm   529 SGSCTTGM---DPVVLLVKDIKTLDRKEFLNDSVMAFMLNYIAFMLSSELMK------SVHMCNT 584

  Fly  1365 F-------FMP---------------RLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCM- 1406
            |       .:|               ::::.....|.|||||.|:.:||.|.:|:: .::||.: 
 Worm   585 FLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPIN-EDLHWLVI 648

  Fly  1407 -------AIIHLRNKT---------IFYYDSMGRPNQPALDA--------LVKYLHEESLDKRKQ 1447
                   ||:.:.|:.         |.::|.:.     .||.        .:|....:..:..|.
 Worm   649 AVINPSGAIVDMSNEEASRAAPKCYIVFFDPLS-----GLDPSKKNHMCHCIKIYLAQLYENTKA 708

  Fly  1448 P-----------FDMTGFVVENAQNIPRQGNSSDCGVFSCMFAE----YITRDVPI 1488
            |           :|....||..|:|.|.|.|..|||::...|.|    |..|.|.:
 Worm   709 PGMKFASKNPTIYDEERVVVTRAENTPIQDNFYDCGLYVLHFIEGLFCYPNRPVNV 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 51/225 (23%)
ulp-2NP_494914.1 Peptidase_C48 553..771 CDD:280975 51/225 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.