DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and 4930444G20Rik

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_444494.1 Gene:4930444G20Rik MGIID:2149738 Length:495 Species:Mus musculus

Alignment Length:571 Identity:151/572 (26%)
Similarity:236/572 (41%) Gaps:149/572 (26%)


  Fly   998 NGISESR------VNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGSRYLKPG 1056
            :||.:.|      |....|..:.:||.|          .|:|.             .|..:.:||
Mouse    16 SGIGQKRKYHDESVTEIESEPLGQEPKR----------KCQDG-------------TGMVFKEPG 57

  Fly  1057 TPPTFQR-----------AKAQSATSSSCS-LQDNQSN----ITDSFPSPHGRA----------- 1094
            ..|..|.           .|.|..|..... |:..:.:    :|...|:..|:.           
Mouse    58 KEPRDQELPREHPSKGQVRKPQGKTPKQLEPLELTEGSPEQVVTGRKPADGGKGHKRPYSVMEEN 122

  Fly  1095 --NPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEP 1157
              :|:..:|.:|:...:.:::.|..|.:|....:|:..      .....|..|..|..:.||.||
Mouse   123 EQSPQKEKYGRLLQHLQCDQDVSSDPHRPHPFLTNTWK------IKGGESEDSRGSERTQSDREP 181

  Fly  1158 MLV---KD--SPEVKE--ANEANEANEANEA--NETKENDAPQPTTTRIKKPDFLHRRFANCIFL 1213
            ..|   |:  |||.:|  .:|.....|..:.  .|.:..::.:|.....:....|.....|.:| 
Mouse   182 STVVALKECLSPEEREKCCSEEKCVTEKKDCIKGEGRRGNSLEPDLPGTQAQIILDSGKGNSLF- 245

  Fly  1214 RNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGP-- 1276
                                           .:|...||.|||             |..:.|.  
Mouse   246 -------------------------------PNKVAVLAAEKK-------------PITDRGKGR 266

  Fly  1277 --------LEQPEEKKETKLIPLTKEDHARFQEMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWL 1333
                    .|..|::.|..|.|..:|           |:.::   ::.|||:..||.|..:|:||
Mouse   267 EMDQILDITEDMEKEIENALGPGPQE-----------EILSS---RFKLQISRGDIQTLENGQWL 317

  Fly  1334 NDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVH 1398
            ||.:|||||::|.||:|.:.  .||.:..:|||.|:|...||:.|:||||.::||.|::|.||:|
Mouse   318 NDEVINFYMNLLVERNENQG--YPALHVFSTFFYPKLKHGGYSSVKRWTRGINLFEKELILVPIH 380

  Fly  1399 CGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRK---QPFDMTGFVVENAQ 1460
             ..|||.:.:|.||.::|.|.||||:..:...:.:.:||..||..:|.   .|.:...:.| .::
Mouse   381 -QRVHWSLVVIDLRKRSIVYLDSMGQTGKSICETIFQYLQNESKTRRNVELDPLEWKQYSV-TSE 443

  Fly  1461 NIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            .||.|.|.||||:|:|.:|:||.||.|:||||..|..||.:|..||...:|
Mouse   444 EIPLQLNGSDCGMFTCKYADYIARDQPVTFSQQHMPTFRKRMVWEILHSQL 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 78/178 (44%)
4930444G20RikNP_444494.1 Peptidase_C48 <272..490 CDD:304959 93/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130979
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5705
TreeFam 1 0.960
77.000

Return to query results.
Submit another query.