DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and LOC103692995

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_017458985.1 Gene:LOC103692995 RGDID:9174101 Length:697 Species:Rattus norvegicus

Alignment Length:769 Identity:203/770 (26%)
Similarity:315/770 (41%) Gaps:186/770 (24%)


  Fly   855 WYSSRESETDST--DTGTGFQAQNGKGFGAGRQPENSFLSQKRRNQEENPRLIKYRRVDNSFPRL 917
            |..|.|...|..  |.|......:...|.|...|.:.|...:....::  :::.:|:  .:..|.
  Rat     2 WSLSLEDTADGVKMDAGEVTLVNHSSAFRAHLLPHSGFPEDQLALSDQ--QILPFRQ--GTLHRA 62

  Fly   918 ITNETAEDLI-PN-----------NSMAKRDQPQSSKRLSIFNPPVYTQH---RVRNDAPHVPTP 967
            .|..|:.... |:           :...||..|.|...|...:...:.|.   :.||..|...:.
  Rat    63 FTGSTSSAAYNPDYHSGFFVSKMRSPPLKRHNPSSDSFLGSGDIRTFGQSANGQWRNSTPASGSA 127

  Fly   968 FDDEESSQRL-ANAGPSSRPM----TYSDAVRLGHNGISESRVNGH-----SSHTVRREPS---- 1018
            .....:|:.| .....:||..    ..:|:..|.:..:.:|..:.|     .|..::..||    
  Rat   128 LQKPRNSRSLYLETRKTSRCRILWNRVTDSCGLSNTFVGKSNHHCHVSAYEKSFPIKPAPSPSWS 192

  Fly  1019 -RLHRSILSHEMNCKDQEQY----NELIRTQTNYVGSRYLKPGTPPTFQRAKAQS---ATSSSCS 1075
             ...||:||.:   |.|.::    .|.::.:...:..:.|:..|...|..||..:   ...|.| 
  Rat   193 GSCRRSLLSPK---KTQRRHFSTAEETVQEEEKEIYRQLLQMVTGKQFSVAKPTTHFPLHLSRC- 253

  Fly  1076 LQDNQSNITDSFPSPHGRANPELTEYAKLINRQENEENRSPAPQQPKRNASNSSASH--ASTISS 1138
            |..|::::.||.                                  .|| .||.|||  .|..||
  Rat   254 LSSNKNSLKDSL----------------------------------LRN-GNSCASHVIGSDTSS 283

  Fly  1139 SASSSCSTCSTCSSSDTEPMLVKDSPEV----------------------KEANEANEANEANEA 1181
            |.|:|..|... ..|.:...|:..:|:|                      ..:|..:|.:::...
  Rat   284 SGSASILTAQE-QLSHSAHSLISGTPDVAFGSKDSALHHHLSAPHQPDSLPASNPQSEGSDSVIL 347

  Fly  1182 NETKENDAPQPTTTRIKKP----------------DFLHRRFANCIFLRNDF-------AENFKA 1223
            .:.||:..|   .:|...|                |.|.   ::..|.:.:.       ..:.:|
  Rat   348 LKVKESQTP---ASRYLSPLKRSTCPYIIPYSAVTDLLS---SSPTFFQAELWIKELTSVYDSRA 406

  Fly  1224 RANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKL 1288
            |...||:|....|.:..|.....:.|....:..  |:..|.           |||        |.
  Rat   407 RERLRQIEEQKALALQLQNQRLQEQEHAVLDSV--ELHLRV-----------PLE--------KE 450

  Fly  1289 IPLT------KEDHA------RFQEMT-TIEVTTNLIFK-----------YNLQITTDDIFTFVD 1329
            :|:|      |:.|.      .|.|:| .:|.....:|:           :.|.||..||.|...
  Rat   451 VPVTAAQETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNH 515

  Fly  1330 GEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIP 1394
            ..||||.||||||:||.|||:::.  .|:.:|.||||..:|..|||..|:|||:|||:||.||:.
  Rat   516 LNWLNDEIINFYMNMLMERSKEKG--FPSVHAFNTFFFTKLKAAGYQAVKRWTKKVDVFSVDILL 578

  Fly  1395 VPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVV--E 1457
            ||:|.| ||||:|::..|.|::.||||||..|..|...|::||.:||:||:::.||..|:.:  :
  Rat   579 VPIHLG-VHWCLAVVDFRKKSVTYYDSMGGVNNEACRILLQYLKQESVDKKRKEFDTNGWQLFSK 642

  Fly  1458 NAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511
            .:|.||:|.|.||||:|:|.:|:.||:|.||.|:|..|.|||.:|..||...||
  Rat   643 KSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKL 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 90/177 (51%)
LOC103692995XP_017458985.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.