DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and LOC101733270

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_012810891.1 Gene:LOC101733270 ID: Length:377 Species:Xenopus tropicalis

Alignment Length:279 Identity:56/280 (20%)
Similarity:86/280 (31%) Gaps:128/280 (46%)


  Fly    76 RGSEEAAANATATQLLWAENQGLPTSHLLPTEQAFETLNTNAYCSPPGDSR--FTFPSQNYSPLL 138
            ||:||.|:.|...    ||.:..|                     |.|.::  |..||:....|:
 Frog   141 RGAEEVASLANHV----AEEETEP---------------------PHGVAKGFFPVPSKTEPILI 180

  Fly   139 PRCVPVPNQRYSPDGSPIHQLHELQNCPLIDSPIRLRFPSPLPEPPSLPTITLT----------- 192
            ...:|..|:.......|:.| .||               :|.||..:.||:|||           
 Frog   181 RNVLPCANKETPATNGPLPQ-EEL---------------TPPPEKEAPPTVTLTQEHVACVQSIL 229

  Fly   193 ------------------VDALIDLDQNN--------QVAYYVQQYNNQP---------VLYQQN 222
                              |:.|.|:.|.:        .|.:.:|.|...|         |.|:::
 Frog   230 DQFLQTYGSLIPLGTDEVVEKLEDVFQQSFSTPARRTVVQHVIQSYQRHPGNAMLRGFRVTYKRH 294

  Fly   223 I----HIGTGIQLCDQASENNQPIILHIVEHNP-------------QTITESQEQFHQVVPEIQI 270
            :    .:||   |..|...|:|      |.|.|             .::.|.|.:          
 Frog   295 VLSMDDLGT---LYGQNWLNDQ------VRHRPLHTGGNKGTGGGNNSVCEGQGE---------- 340

  Fly   271 NNIQEQDQKFENGISEQNH 289
            ..|.|:.:   |.:||..|
 Frog   341 GAIMERSR---NEMSEAGH 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064 24/125 (19%)
Peptidase_C48 1331..1506 CDD:280975
LOC101733270XP_012810891.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.