DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and senp1

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_002933743.1 Gene:senp1 XenbaseID:XB-GENE-1014921 Length:621 Species:Xenopus tropicalis

Alignment Length:586 Identity:184/587 (31%)
Similarity:265/587 (45%) Gaps:152/587 (26%)


  Fly  1036 QYNELIRTQTNYVGSRYL--------KPGTP-PTFQRAKAQSATSSSCSLQDNQ---SNITDSFP 1088
            |.:|||:.:.|..|...|        ||..| .:...|:..|...::.|::.|.   |....|||
 Frog    77 QSSELIKGKQNGNGYAMLPAKGIFFQKPRVPRSSHMEARKPSGALNAVSVKPNHTVTSAYEKSFP 141

  Fly  1089 ----------------SPH--GRANPELTEYAKLINRQENE-----------------ENRSPAP 1118
                            ||.  .|..|...|  :.:..:|.|                 ::.|..|
 Frog   142 FKNISCSASLAGPCRRSPKKIQRRLPSTVE--ETVREEEKEIYRQLLQVVTGKSFLATKSTSVLP 204

  Fly  1119 QQPKRNASNSSASH---ASTISSSASSSCSTCSTC---------SSSDTEPMLVKDSPEVKEANE 1171
            .|..|.:|::|...   ||::||...||..|.|:|         |...:||:| .:|...|..::
 Frog   205 PQVSRLSSDNSICGQPIASSLSSLEPSSLDTESSCRTSFSYLQPSGQISEPLL-SNSTNYKVTSD 268

  Fly  1172 ANEANEANEANETKENDAPQPTTTR------------IKKPD----------FLHRRF----ANC 1210
            ...|     :|:....:...||:.:            :.||.          |.|...    ...
 Frog   269 TQGA-----SNQQLPKEKFVPTSQQSQGSDSVIVLDPVVKPQVPGQVPTSQPFFHAELWIKELTS 328

  Fly  1211 IFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDERLAYEKKLREVMFRSGAP-HRPFFEI 1274
            :|       :.:||..|||:|        ||:|...|.::    ::|:|...:.... |      
 Frog   329 LF-------DSRARERRRQIE--------EQKAVALKLQK----QRLQECSVQDSIDLH------ 368

  Fly  1275 GPLEQPEEKKETKLIPLT----KEDHA------RFQEMTTI---EV---------TTNLIFKYNL 1317
              |..|.||:    ||:|    :||.:      .|.|:|..   |:         ...|...|.|
 Frog   369 --LRVPLEKE----IPVTLIQKQEDESTQSEEIEFPELTEAMEREIKRALFGGSQDQTLSEGYRL 427

  Fly  1318 QITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWT 1382
            .||..||.|.....||||.||||||:::.||| ||.| ||..:|.||||..:|..|||..|:|||
 Frog   428 TITRKDIMTLHSLNWLNDEIINFYMNLIMERS-KRKG-LPKVHAFNTFFFTKLKSAGYQAVKRWT 490

  Fly  1383 RKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQ 1447
            :|||:||.:|:.||:|.| ||||:|::..|.|:|.|:||||..|..|...|::||.:||:||:..
 Frog   491 KKVDIFSMNILLVPIHLG-VHWCLAVVDFRKKSILYFDSMGGLNNEACKILLQYLKQESIDKKGV 554

  Fly  1448 PFDMTGFVV--ENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGK 1510
            .||..|:.:  :.::.||:|.|.||||:|:|.:|:|||:|..|||:|..|.|||.||..||...|
 Frog   555 SFDSNGWTLTSKTSEEIPQQMNGSDCGMFACKYADYITKDKSITFTQRHMPYFRKKMVWEILHQK 619

  Fly  1511 L 1511
            |
 Frog   620 L 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 92/177 (52%)
senp1XP_002933743.1 Peptidase_C48 <355..619 CDD:304959 117/279 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.