DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and si:dkey-21c19.3

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_001343517.1 Gene:si:dkey-21c19.3 ZFINID:ZDB-GENE-030131-6462 Length:729 Species:Danio rerio

Alignment Length:782 Identity:214/783 (27%)
Similarity:336/783 (43%) Gaps:203/783 (26%)


  Fly   869 GTGFQA-QNGKGFGA----GRQPENSFLSQKRRN-------QEENPRLIKYRRVDNSFPRLITNE 921
            ||||.: :||...||    ..:.:....|:::|:       .:|..|::|..|:.:....:  ..
Zfish    10 GTGFASLRNGAPAGAVNADAARVDQDGTSRRKRSINCLNDGDQEEERVVKKFRMGDIMDTV--KN 72

  Fly   922 TAEDLIPNNSMAKRDQPQSSKRLSIFNPPVYTQHRV----RNDAPHVPTP--------------- 967
            .||.:..:.|                |...:.::.|    ||..|..|.|               
Zfish    73 AAEGVKTHGS----------------NVAFWVKNSVSANSRNMLPTSPGPPQSGIPSGPAANSTS 121

  Fly   968 ---FDDEESSQRLAN--AGPSS----RPMTYSDAVRLGHN-GISES---------------RVNG 1007
               :.:::...||.:  ..|||    |.:|.||::|..|: .||::               :.||
Zfish   122 TSLWTEDKPHDRLQDTFVAPSSSVEWRTVTKSDSLRTEHSVTISKTSRRQVCMEHPPHEMYKANG 186

  Fly  1008 H-----SSHTVRREPS-RL-----HR--SILSHEMNCKDQEQYNEL------IRTQTNYVGSRYL 1053
            |     ||.|.:..|| ||     ||  ||||.......:..|..|      ||...:.:     
Zfish   187 HSVNLPSSSTPKPSPSPRLGRSLYHRPQSILSSPETSSGKATYTSLYEKTFPIRVVQSSL----- 246

  Fly  1054 KPGTPPTFQRAKAQSATSSSCSLQDNQ---------SNITDSF---PSPHG--RANPELTEYAKL 1104
             ||:.....||:|:|....|...::.:         |....||   .|.|.  |::.:.:.:  |
Zfish   247 -PGSSNRLLRARARSTAQESVREEEKEVYRQLLVMVSEGQSSFLHDGSSHSSIRSHRDFSSF--L 308

  Fly  1105 INRQENEENRSPA--------------PQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDT 1155
            .:.:......|||              |..|:..:|.:|    |.:.|..::|........:.|.
Zfish   309 SSSRSLLHCASPAGSGAGVSSYGLSSPPPSPQPGSSQTS----SALPSPGAASSLAEPPLWAHDL 369

  Fly  1156 EPMLVKDSPEVKEA------------NEANEANEANEANETKENDAPQPTTTRIKKPDFLHRRFA 1208
            ||.  ...|:|..|            :..:.|::.:.....||....:|.::.:  |.|....:.
Zfish   370 EPS--AKGPDVPSAPSPAALQDTSSQDTQSSAHDGDSVIFVKEQQGKKPESSSV--PCFQAELWI 430

  Fly  1209 NCIFLRNDFAENFKARANRRQLESMHLLG---IAEQQANESKDERLAYEKKLREVMFRSGAPHRP 1270
            ..:....|    .:||..||.:|....|.   :.::.:.|.:....:.|.|:|.           
Zfish   431 KELTSLYD----SRARERRRLIEEQEALASQLLRQRLSGEGRASPASVELKVRV----------- 480

  Fly  1271 FFEIGPLEQPEEKKETKLIPLTK-----EDHARFQEMTTIEVTTNLIFK--------------YN 1316
                 |||     ||..:..:.|     ::...|.|:|  |...|.:.:              :.
Zfish   481 -----PLE-----KEVPIAAVIKKPQPIKEEPEFPELT--EEMENDVSRALRGGSQDEILSEGFR 533

  Fly  1317 LQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRW 1381
            |.||..|:.|.....||||.:|||||::|.|||::  .:||:.|..||||.|:|..:||:.||||
Zfish   534 LTITRKDLQTLSHLNWLNDEVINFYMNLLVERSKQ--PDLPSAYTFNTFFFPKLRSSGYSAVRRW 596

  Fly  1382 TRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRK 1446
            |:|||:||.|:|.||||.| ||||::::..|||:|.|:||||..|..|...|:.||.:||.||:.
Zfish   597 TKKVDIFSVDLILVPVHLG-VHWCLSVVDFRNKSITYFDSMGGNNDEACRILLNYLKQESEDKKG 660

  Fly  1447 QPFDMTGFVVENAQ--NIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADG 1509
            |..:.:|:.:::.:  .||:|.|.||||:|:|.:|||||:|..|||:|..|.|||.:|..||.:.
Zfish   661 QKMETSGWSLKSKRPNEIPQQMNGSDCGMFTCKYAEYITKDRSITFTQKHMPYFRKRMVWEILNR 725

  Fly  1510 KL 1511
            ||
Zfish   726 KL 727

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 91/177 (51%)
si:dkey-21c19.3XP_001343517.1 Peptidase_C48 <490..726 CDD:304959 103/241 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T128728
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.