DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ulp1 and senp7b

Sequence 1:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:XP_005161832.1 Gene:senp7b ZFINID:ZDB-GENE-060531-45 Length:884 Species:Danio rerio

Alignment Length:869 Identity:167/870 (19%)
Similarity:283/870 (33%) Gaps:313/870 (36%)


  Fly   884 RQPENS----FLSQKRRNQEENPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKR- 943
            :||.:|    ..|...|.|::|.:..::..|  :|.....::|:.:   .|.::|..|...|.| 
Zfish    30 KQPSDSCSLDMQSPLSRLQDDNSQKSQWGSV--TFNGRTPHKTSSN---ENMLSKDSQRSDSLRG 89

  Fly   944 -------LSIFNPPVYTQHRVRNDAPH-------------VPTPFDDEESSQRLANAGPSSRPMT 988
                   ..:...|:.......|..||             .||...|..::.|.       ||..
Zfish    90 ATRGRFSFKMNQQPIKISPARVNGTPHKVSDTSGFRPQCQTPTTAPDFTANNRW-------RPKR 147

  Fly   989 YSDAVRLGHNGISESRVNGHSSHTVRREPS--RLHRSILSHEMNCKDQE---QYNELIRTQTNYV 1048
            .||.: |.|:          .:||...|.|  ::||.:.|.|:..::.|   .::::..||....
Zfish   148 ASDRL-LSHD----------ENHTKASECSAFKIHRGLDSEELEEEETEGTQGHSQVKETQRATS 201

  Fly  1049 GSRYLKPGTPPTFQRA--KAQSATSSSCSLQDNQSNI-TDSFPSPHGRANPELTEYAKLINR--- 1107
            ...|........|::|  |.::.|..:.|...|.|.: ....|:.|.|.:.|....:..:.:   
Zfish   202 SEDYKVTSAASVFEKATSKHKNGTEKAVSKPFNHSGLHVQEAPARHLRTSEERAASSVPVRKDPL 266

  Fly  1108 -QENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTCSSSDTEPMLVKDSPEVKEANE 1171
             .|..||:|..|         .::.::|.:.....|.|.|......|.|||:::....|  .|||
Zfish   267 TSETAENKSKDP---------FASFYSSKLRRKPQSFCKTYKRTKPSSTEPIVLSSDDE--GANE 320

  Fly  1172 ANEAN---------------EANEANETKENDAPQPTTTRIKKPDFLHRRFANCIFLRNDFAENF 1221
            .|:.:               :......:|.|...:.:||:::.|..:...|:...:      :..
Zfish   321 VNDVSGGLQEQRISEGIRDTQTGNQKSSKTNVGGERSTTKVEVPSIMELEFSRLHY------DTI 379

  Fly  1222 KARAN------------------------------RRQLESM---------HLLGIAEQQA---- 1243
            :|:||                              :.|:..|         .||.|.|:.|    
Zfish   380 QAQANGTVVITDEGISIPLKDADGEGEVAISISCSQLQMYGMWDGGLASDGSLLSITEEPAPSLF 444

  Fly  1244 -------------------------------------NESKDERLAYEKKLREVM---------- 1261
                                                 .:..|.|:|....|.:|:          
Zfish   445 FLMVSDAQARLLRKELSLQYNTHTSGQACPFVLLVLSGQLDDLRVALLASLMDVIGLRYAQDSLS 509

  Fly  1262 ----FRSGA------PHRPFF---------EIGPLEQPEE----KKETKLIPLTKEDHARFQEMT 1303
                :..|.      |....|         :.|..:..|.    |:.|...||  ..|::.|.: 
Zfish   510 NPVSWADGLSRLLCHPRGEHFLSLLGQNCKDTGQDKAKENASGIKEPTARRPL--RSHSKPQSL- 571

  Fly  1304 TIEVTTNLI------FKYNLQITTDDIFTFVDGEWLNDAIINFYMS-MLTERSEKRAGELPATYA 1361
                ...||      .|..:.:||:|:....|||:|||.||:||:. :|.||::|...|  .::.
Zfish   572 ----PRRLIQYPPPPSKGGITVTTEDLECLKDGEFLNDVIIDFYLKYLLLERADKDIAE--RSHI 630

  Fly  1362 MNTFFMPRLLQAGYAG---------------VRRWTRKVDLFSKDIIPVPVHCGNVHWCMA---- 1407
            .::||..:|.:...:|               ||.|||.||:||||.:.:||: ...||.:.    
Zfish   631 FSSFFYKQLTRKDTSGPEETGSTSAYRRHQRVRTWTRHVDIFSKDYLFIPVN-HEAHWYLVLICF 694

  Fly  1408 -------IIHLRNKTIFYYDS--------------------MGRP---------NQPALDALVKY 1436
                   |:..|.|:....|.                    .|.|         |.|  |..|..
Zfish   695 PALERPQIVEWRQKSSVSQDESQTTKERPSGESQRESSQQPKGNPSKINESRSHNLP--DCTVHS 757

  Fly  1437 LHEESLDKRKQPFDMTGFVVENAQ----------------------------------NIPRQGN 1467
            ..:|::.||.....|....:...|                                  .:|.|.|
Zfish   758 CTKETICKRPCILIMDSLKLSYHQRTYTLLREYLQVEWEVRKGSCRSFSNESITGSLCRVPLQDN 822

  Fly  1468 SSDCGVFSCMFAEYITRDVPITFS 1491
            |||||::...:.|...::..:.|:
Zfish   823 SSDCGLYLLQYVESFLQNPVVDFA 846

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 57/252 (23%)
senp7bXP_005161832.1 Peptidase_C48 601..845 CDD:304959 56/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.