DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and JJJ2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae

Alignment Length:413 Identity:83/414 (20%)
Similarity:165/414 (40%) Gaps:91/414 (22%)


  Fly    41 FYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLK 105
            :|..:|:...||.:||.:::..|:.:|||||..::.:...|:.:|..:.:|.|..::.:|||.||
Yeast    14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKLRYDRDLK 78

  Fly   106 -EGMPNW--KSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQVFG------ 161
             :|:..:  |...:.::...|..  :||     ..|:||   :.|.:.:.|...:|.:|      
Yeast    79 IKGLHTYQPKKNCHIFKTKAKES--QGA-----SPTLGQ---SEAYHRQNKPYEQQPYGFGVGKK 133

  Fly   162 ----TKLK--------------------KLQKKNKNIDMDVILSEIPMPSLL----------NTL 192
                :|.|                    |.::|:.:.|:|.:..|....|.:          |:.
Yeast   134 MTSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSPDIDSLFHETNGASKVRMTDAGKMDTNSQ 198

  Fly   193 PIQIPLALWNLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARL--------- 248
            ..:|...|.....|.|:.....|.....||....:|.||.::|::.:::.::|...         
Yeast   199 FQEIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQQQQQQQQQQQQQHYGMTSKSSSP 263

  Fly   249 RKEHKENLRKRKQNSKAPEKTEEELRGYSQIQTRELTDDDAVRPASQKSTVSGGFWTDE------ 307
            .:|.|.|...::::..:||:..||..|:.|.   :|.........|..|.:...|:..|      
Yeast   264 DEEKKNNKEPKRESRVSPEENGEEETGHKQF---KLPKTSTFSSGSHDSNLQSPFYNHEYRHYAR 325

  Fly   308 -------DLTELIRLVKKYPG--GAGSRWN---TIAESMNRS-----VQEVTFMAAKMKENGYRI 355
                   ...:.:..:|:.|.  .|...||   .|.|.:|.|     .:::.|   :..|.|.:.
Yeast   326 SKFECKNQFRKSVSPIKEIPATTSANEGWNILRDIIEKLNISNVDDRNKDLLF---RRDEIGDKN 387

  Fly   356 PGQTDSVAEALVQESQQAQRKEK 378
            ...:..:....::|.:..:|::|
Yeast   388 HSDSIDIENLSIKEPKGMKRRKK 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 17/60 (28%)
SANT 301..>341 CDD:197842 11/63 (17%)
SANT 304..341 CDD:238096 10/60 (17%)
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
JJJ2NP_012373.2 DnaJ 13..74 CDD:278647 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1934
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.