DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and ZUO1

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_011801.1 Gene:ZUO1 SGDID:S000003517 Length:433 Species:Saccharomyces cerevisiae

Alignment Length:492 Identity:94/493 (19%)
Similarity:169/493 (34%) Gaps:174/493 (35%)


  Fly    26 EELEIFDLVEEVNRNFYEFMGINQ---TATGAEVKRAFRTLSIVLHPDKNPAEDANIQ----FRN 83
            |:|...|..:....:.|..||:::   .||.:::.:|.|...:..||||..|...::.    |:.
Yeast    83 EDLLTHDARDWKTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKI 147

  Fly    84 LVSIYEVLKDPSRREKYDR--VLKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAW 146
            :...:|.|.|.::|.:||.  .:.:..|..|...|.:        ||                ||
Yeast   148 IQKAFETLTDSNKRAQYDSCDFVADVPPPKKGTDYDF--------YE----------------AW 188

  Fly   147 AAYLEKKYTAEQVFGTKLKKLQKKNKNIDMDVILSEIPMPSLLN----TLPIQIPLALWNLPRTI 207
            ....|    ||..|..|                   .|:|||.|    ...::...|.|:     
Yeast   189 GPVFE----AEARFSKK-------------------TPIPSLGNKDSSKKEVEQFYAFWH----- 225

  Fly   208 KNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEE 272
                                ..::.|..|.|:.:..:.:. .::||..:.::.:.::..:||.:.
Yeast   226 --------------------RFDSWRTFEFLDEDVPDDSS-NRDHKRYIERKNKAARDKKKTADN 269

  Fly   273 LRGYSQIQTRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKYPGGAGSRWNTIAESMNRS 337
            .|....:: |.:::|..::           .:.:|:..|..|  :|:...||:|           
Yeast   270 ARLVKLVE-RAVSEDPRIK-----------MFKEEEKKEKER--RKWEREAGAR----------- 309

  Fly   338 VQEVTFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKEKVK-KAAANAGASAEKSMLIPETNW 401
                                     |||..:...:|:.|.|.: :|.|||.|.|:|         
Yeast   310 -------------------------AEAEAKAKAEAEAKAKAESEAKANASAKADK--------- 340

  Fly   402 TQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEEANEPDE 466
                ::|.|||     |.|.....:.|.||..|.         .|..:        .::|...||
Yeast   341 ----KKAKEAA-----KAAKKKNKRAIRNSAKEA---------DYFGD--------ADKATTIDE 379

  Fly   467 DAAAIEEELPEEEPLAPPEPEVAPA--AKKLSKREQR 501
            ....|.:.|.:||.::..:...|.|  ||::.|...:
Yeast   380 QVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAK 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 18/68 (26%)
SANT 301..>341 CDD:197842 7/40 (18%)
SANT 304..341 CDD:238096 7/37 (19%)
SANT 399..447 CDD:197842 11/48 (23%)
SANT 400..447 CDD:238096 11/47 (23%)
ZUO1NP_011801.1 ZUO1 50..433 CDD:227594 94/493 (19%)
DnaJ 97..165 CDD:278647 18/68 (26%)
RAC_head 357..425 CDD:293322 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.